Homologs in group_977

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04830 FBDBKF_04830 100.0 Morganella morganii S1 ykgO type B 50S ribosomal protein L36
EHELCC_06120 EHELCC_06120 100.0 Morganella morganii S2 ykgO type B 50S ribosomal protein L36
NLDBIP_06440 NLDBIP_06440 100.0 Morganella morganii S4 ykgO type B 50S ribosomal protein L36
LHKJJB_03320 LHKJJB_03320 100.0 Morganella morganii S3 ykgO type B 50S ribosomal protein L36
F4V73_RS09285 F4V73_RS09285 100.0 Morganella psychrotolerans ykgO type B 50S ribosomal protein L36
PMI_RS16820 PMI_RS16820 92.7 Proteus mirabilis HI4320 ykgO type B 50S ribosomal protein L36

Distribution of the homologs in the orthogroup group_977

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_977

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A4TPC0 3.54e-22 81 92 0 41 3 rpmJ Large ribosomal subunit protein bL36 Yersinia pestis (strain Pestoides F)
Q1CL43 3.54e-22 81 92 0 41 3 rpmJ Large ribosomal subunit protein bL36 Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZN1 3.54e-22 81 92 0 41 3 rpmJ Large ribosomal subunit protein bL36 Yersinia pestis bv. Antiqua (strain Angola)
Q1C4N0 3.54e-22 81 92 0 41 3 rpmJ Large ribosomal subunit protein bL36 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLA2 3.54e-22 81 92 0 41 3 rpmJ Large ribosomal subunit protein bL36 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JHP8 3.54e-22 81 92 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66DR2 3.54e-22 81 92 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZC86 3.54e-22 81 92 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Yersinia pestis
B2K6Y0 3.54e-22 81 92 0 41 3 rpmJ1 Large ribosomal subunit protein bL36A Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A1JNH6 3.54e-22 81 92 0 41 3 rpmJ1 Large ribosomal subunit protein bL36A Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GAT8 2.25e-21 79 87 0 41 3 rpmJ Large ribosomal subunit protein bL36 Serratia proteamaculans (strain 568)
Q7NA99 2.3e-21 79 90 0 41 3 rpmJ Large ribosomal subunit protein bL36 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8AJY9 8.78e-21 78 85 0 41 3 rpmJ Large ribosomal subunit protein bL36 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4W7D9 8.78e-21 78 85 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Enterobacter sp. (strain 638)
A7MFN6 3.83e-20 76 82 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Cronobacter sakazakii (strain ATCC BAA-894)
B4TME8 4.32e-20 76 80 0 41 3 rpmJ Large ribosomal subunit protein bL36 Salmonella schwarzengrund (strain CVM19633)
C0Q7Z4 4.32e-20 76 80 0 41 3 rpmJ Large ribosomal subunit protein bL36 Salmonella paratyphi C (strain RKS4594)
A9MWA7 4.32e-20 76 80 0 41 3 rpmJ Large ribosomal subunit protein bL36 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SWW3 4.32e-20 76 80 0 41 3 rpmJ Large ribosomal subunit protein bL36 Salmonella newport (strain SL254)
B4T9G4 4.32e-20 76 80 0 41 3 rpmJ Large ribosomal subunit protein bL36 Salmonella heidelberg (strain SL476)
B5FKX4 4.32e-20 76 80 0 41 3 rpmJ Large ribosomal subunit protein bL36 Salmonella dublin (strain CT_02021853)
B5EXL0 4.32e-20 76 80 0 41 3 rpmJ Large ribosomal subunit protein bL36 Salmonella agona (strain SL483)
P66296 4.32e-20 76 80 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66297 4.32e-20 76 80 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Salmonella typhi
Q5PFM0 4.32e-20 76 80 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57S93 4.32e-20 76 80 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Salmonella choleraesuis (strain SC-B67)
A6T5L7 6.49e-20 75 80 0 41 3 rpmJ Large ribosomal subunit protein bL36 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y0Q3 6.49e-20 75 80 0 41 3 rpmJ Large ribosomal subunit protein bL36 Klebsiella pneumoniae (strain 342)
Q9KTM3 6.6e-20 75 87 0 40 3 rpmJ2 Large ribosomal subunit protein bL36B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F343 6.6e-20 75 87 0 40 3 rpmJ1 Large ribosomal subunit protein bL36A Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B7NK71 1.46e-19 75 78 0 41 3 rpmJ Large ribosomal subunit protein bL36 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q1RFQ0 1.46e-19 75 78 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Escherichia coli (strain UTI89 / UPEC)
B1LHW3 1.46e-19 75 78 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Escherichia coli (strain SMS-3-5 / SECEC)
Q2EEQ2 1.46e-19 75 78 0 41 1 ykgO Large ribosomal subunit protein bL36B Escherichia coli (strain K12)
B1J0X7 1.46e-19 75 78 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FKL1 1.46e-19 75 78 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKY8 1.46e-19 75 78 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZWT3 1.46e-19 75 78 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Escherichia coli O9:H4 (strain HS)
B1XE38 1.46e-19 75 78 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Escherichia coli (strain K12 / DH10B)
A7ZI30 1.46e-19 75 78 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7MIE8 1.49e-19 75 87 0 40 3 rpmJ Large ribosomal subunit protein bL36 Vibrio vulnificus (strain YJ016)
A9C021 1.06e-18 73 85 0 41 3 rpmJ Large ribosomal subunit protein bL36 Delftia acidovorans (strain DSM 14801 / SPH-1)
B6EHZ5 1.16e-18 72 78 0 41 3 rpmJ Large ribosomal subunit protein bL36 Aliivibrio salmonicida (strain LFI1238)
A1KTL0 1.48e-18 72 85 0 40 3 rpmJ2 Large ribosomal subunit protein bL36B Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66295 1.48e-18 72 85 0 40 3 rpmJ2 Large ribosomal subunit protein bL36B Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66294 1.48e-18 72 85 0 40 3 rpmJ2 Large ribosomal subunit protein bL36B Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A7N1X3 2.43e-18 72 80 0 40 3 rpmJ2 Large ribosomal subunit protein bL36B Vibrio campbellii (strain ATCC BAA-1116)
Q4KA27 3.04e-18 72 82 0 41 3 rpmJ Large ribosomal subunit protein bL36 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C5BFR3 3.16e-18 71 80 0 40 3 rpmJ Large ribosomal subunit protein bL36 Edwardsiella ictaluri (strain 93-146)
A0KJJ0 3.38e-18 71 82 0 40 3 rpmJ Large ribosomal subunit protein bL36 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SNF1 3.38e-18 71 82 0 40 3 rpmJ1 Large ribosomal subunit protein bL36A Aeromonas salmonicida (strain A449)
A9M4E0 4.3e-18 71 82 0 40 3 rpmJ2 Large ribosomal subunit protein bL36B Neisseria meningitidis serogroup C (strain 053442)
B4RL58 4.59e-18 71 82 0 40 3 rpmJ Large ribosomal subunit protein bL36 Neisseria gonorrhoeae (strain NCCP11945)
Q5F860 4.59e-18 71 82 0 40 3 rpmJ Large ribosomal subunit protein bL36 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B0BSZ4 2.41e-17 69 75 0 40 3 rpmJ2 Large ribosomal subunit protein bL36B Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N3B8 2.41e-17 69 75 0 40 3 rpmJ2 Large ribosomal subunit protein bL36B Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B2FNP3 2.58e-17 69 82 0 40 3 rpmJ Large ribosomal subunit protein bL36 Stenotrophomonas maltophilia (strain K279a)
B4SSV0 2.58e-17 69 82 0 40 3 rpmJ Large ribosomal subunit protein bL36 Stenotrophomonas maltophilia (strain R551-3)
B0U3S9 3.14e-17 68 80 0 40 3 rpmJ Large ribosomal subunit protein bL36 Xylella fastidiosa (strain M12)
Q9PAQ5 3.14e-17 68 80 0 40 3 rpmJ Large ribosomal subunit protein bL36 Xylella fastidiosa (strain 9a5c)
B2SLH7 3.43e-17 68 80 0 40 3 rpmJ Large ribosomal subunit protein bL36 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P3S4 3.43e-17 68 80 0 40 3 rpmJ Large ribosomal subunit protein bL36 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BSN4 3.43e-17 68 80 0 40 3 rpmJ Large ribosomal subunit protein bL36 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P66310 3.43e-17 68 80 0 40 3 rpmJ Large ribosomal subunit protein bL36 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RSA2 3.43e-17 68 80 0 40 3 rpmJ Large ribosomal subunit protein bL36 Xanthomonas campestris pv. campestris (strain B100)
Q4UVD8 3.43e-17 68 80 0 40 3 rpmJ Large ribosomal subunit protein bL36 Xanthomonas campestris pv. campestris (strain 8004)
P66309 3.43e-17 68 80 0 40 3 rpmJ Large ribosomal subunit protein bL36 Xanthomonas axonopodis pv. citri (strain 306)
Q7VKI0 4.99e-17 68 72 0 40 3 rpmJ2 Large ribosomal subunit protein bL36B Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B7V9F5 1.59e-16 67 75 0 41 3 rpmJ Large ribosomal subunit protein bL36 Pseudomonas aeruginosa (strain LESB58)
Q9HY26 1.59e-16 67 75 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02R72 1.59e-16 67 75 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V1J0 1.59e-16 67 75 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Pseudomonas aeruginosa (strain PA7)
Q1H1T1 2.13e-16 67 77 0 40 3 rpmJ2 Large ribosomal subunit protein bL36B Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q87BJ5 3.73e-16 66 77 0 40 3 rpmJ Large ribosomal subunit protein bL36 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6X3 3.73e-16 66 77 0 40 3 rpmJ Large ribosomal subunit protein bL36 Xylella fastidiosa (strain M23)
Q31G58 1.47e-15 64 72 0 40 3 rpmJ Large ribosomal subunit protein bL36 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q7UQB3 2.37e-15 64 68 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q3IC33 6.89e-15 63 73 1 41 3 rpmJ Large ribosomal subunit protein bL36 Pseudoalteromonas translucida (strain TAC 125)
Q0BWX0 1.05e-14 62 73 0 41 3 rpmJ Large ribosomal subunit protein bL36 Hyphomonas neptunium (strain ATCC 15444)
B4RA25 2.15e-14 62 70 0 41 3 rpmJ Large ribosomal subunit protein bL36 Phenylobacterium zucineum (strain HLK1)
Q3YS78 3.84e-14 61 73 0 41 3 rpmJ Large ribosomal subunit protein bL36 Ehrlichia canis (strain Jake)
B1ZWF5 4.02e-14 61 68 0 41 3 rpmJ Large ribosomal subunit protein bL36 Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
Q2GGG8 6.51e-14 60 70 0 41 3 rpmJ Large ribosomal subunit protein bL36 Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
A1AY28 7.69e-14 60 68 0 41 3 rpmJ Large ribosomal subunit protein bL36 Paracoccus denitrificans (strain Pd 1222)
Q5PAT1 7.84e-14 60 73 0 41 3 rpmJ Large ribosomal subunit protein bL36 Anaplasma marginale (strain St. Maries)
Q5HBD4 8.19e-14 60 70 0 41 3 rpmJ Large ribosomal subunit protein bL36 Ehrlichia ruminantium (strain Welgevonden)
Q5FH38 8.19e-14 60 70 0 41 3 rpmJ Large ribosomal subunit protein bL36 Ehrlichia ruminantium (strain Gardel)
Q2GKJ8 1.31e-13 60 70 0 41 3 rpmJ Large ribosomal subunit protein bL36 Anaplasma phagocytophilum (strain HZ)
B6IP39 2.41e-13 59 65 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q2N7R4 3.91e-13 58 65 0 41 3 rpmJ Large ribosomal subunit protein bL36 Erythrobacter litoralis (strain HTCC2594)
Q2W4X7 4.77e-13 58 65 0 41 3 rpmJ Large ribosomal subunit protein bL36 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B0SVG5 6.41e-13 58 65 0 41 3 rpmJ Large ribosomal subunit protein bL36 Caulobacter sp. (strain K31)
B8H4S1 7.73e-13 58 68 0 41 3 rpmJ Large ribosomal subunit protein bL36 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A383 7.73e-13 58 68 0 41 3 rpmJ Large ribosomal subunit protein bL36 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q0ALN0 1.63e-12 57 63 0 41 3 rpmJ Large ribosomal subunit protein bL36 Maricaulis maris (strain MCS10)
A8GSK8 1.72e-12 57 65 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rickettsia rickettsii (strain Sheila Smith)
B0BY23 1.72e-12 57 65 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rickettsia rickettsii (strain Iowa)
C4K281 1.72e-12 57 65 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rickettsia peacockii (strain Rustic)
Q4ULC2 1.72e-12 57 65 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q92HT9 1.72e-12 57 65 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q1RJ14 1.72e-12 57 65 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rickettsia bellii (strain RML369-C)
A8GVY3 1.72e-12 57 65 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rickettsia bellii (strain OSU 85-389)
A8GNY2 1.72e-12 57 65 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rickettsia akari (strain Hartford)
C3PNU6 1.72e-12 57 65 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rickettsia africae (strain ESF-5)
P28528 2.1e-12 57 63 0 41 3 rpl36 Large ribosomal subunit protein bL36c Guillardia theta
A8LMZ2 2.56e-12 56 63 0 41 3 rpmJ Large ribosomal subunit protein bL36 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A8F1X5 2.83e-12 56 65 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rickettsia massiliae (strain Mtu5)
C3MIL5 2.86e-12 56 60 0 41 3 rpmJ Large ribosomal subunit protein bL36 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A6MW19 4.11e-12 56 60 0 41 3 rpl36 Large ribosomal subunit protein bL36c Rhodomonas salina
Q4G350 4.15e-12 56 60 0 41 3 rpl36 Large ribosomal subunit protein bL36c Emiliania huxleyi
B5ZPD5 4.95e-12 55 63 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q68WS3 5.9e-12 55 63 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZD87 5.9e-12 55 63 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rickettsia prowazekii (strain Madrid E)
P66287 7.77e-12 55 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Brucella suis biovar 1 (strain 1330)
A9WWM1 7.77e-12 55 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VS98 7.77e-12 55 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P66286 7.77e-12 55 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M7P1 7.77e-12 55 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57BD5 7.77e-12 55 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Brucella abortus biovar 1 (strain 9-941)
Q2YRY7 7.77e-12 55 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Brucella abortus (strain 2308)
B2S7H9 7.77e-12 55 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Brucella abortus (strain S19)
Q1GNR9 9.26e-12 55 60 0 41 3 rpmJ Large ribosomal subunit protein bL36 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A5VAZ8 9.26e-12 55 60 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B9J9P2 1.15e-11 55 60 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B9JS22 1.15e-11 55 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
P68993 1.15e-11 55 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2K4E7 1.5e-11 54 60 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PZS1 1.5e-11 54 60 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rhizobium etli (strain CIAT 652)
Q28K48 1.5e-11 54 60 0 41 3 rpmJ Large ribosomal subunit protein bL36 Jannaschia sp. (strain CCS1)
A1URD8 1.71e-11 54 56 0 41 3 rpmJ Large ribosomal subunit protein bL36 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q11D95 2.9e-11 53 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Chelativorans sp. (strain BNC1)
A6UCX4 2.97e-11 53 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Sinorhizobium medicae (strain WSM419)
Q92M65 2.97e-11 53 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rhizobium meliloti (strain 1021)
Q2RRH8 3.31e-11 53 60 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A6WY31 3.35e-11 53 56 0 41 3 rpmJ Large ribosomal subunit protein bL36 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A9H8E4 3.39e-11 53 60 0 41 3 rpmJ Large ribosomal subunit protein bL36 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q2G365 3.58e-11 53 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A9IXS0 3.66e-11 53 51 0 41 3 rpmJ Large ribosomal subunit protein bL36 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q1GKF8 4.81e-11 53 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Ruegeria sp. (strain TM1040)
A5G1L0 4.87e-11 53 60 0 41 3 rpmJ Large ribosomal subunit protein bL36 Acidiphilium cryptum (strain JF-5)
Q2NV67 5.56e-11 53 82 0 41 3 rpmJ1 Large ribosomal subunit protein bL36A Sodalis glossinidius (strain morsitans)
Q6D808 6.07e-11 53 85 0 41 3 rpmJ2 Large ribosomal subunit protein bL36B Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q0BSS2 6.34e-11 53 60 0 41 3 rpmJ Large ribosomal subunit protein bL36 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q5LNC8 6.92e-11 53 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B9KQQ7 6.92e-11 53 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A4WWC9 6.92e-11 53 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q3IY06 6.92e-11 53 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PFS0 6.92e-11 53 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q4FN45 6.99e-11 53 60 0 40 3 rpmJ Large ribosomal subunit protein bL36 Pelagibacter ubique (strain HTCC1062)
A7HUQ6 9.21e-11 52 53 0 41 3 rpmJ Large ribosomal subunit protein bL36 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q6G234 9.41e-11 52 48 0 41 3 rpmJ Large ribosomal subunit protein bL36 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q6FYT6 1.13e-10 52 48 0 41 3 rpmJ Large ribosomal subunit protein bL36 Bartonella quintana (strain Toulouse)
B3CQF1 2.29e-10 51 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Orientia tsutsugamushi (strain Ikeda)
A5CCQ4 2.29e-10 51 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Orientia tsutsugamushi (strain Boryong)
Q3STZ6 3.26e-10 51 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q98FE3 3.8e-10 51 53 0 41 3 rpmJ Large ribosomal subunit protein bL36 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1QP05 4.01e-10 51 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A6GZ77 6.8e-10 50 69 0 33 3 rpmJ Large ribosomal subunit protein bL36 Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
B1M760 8.11e-10 50 56 0 41 3 rpmJ Large ribosomal subunit protein bL36 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B1ZDV2 8.11e-10 50 56 0 41 3 rpmJ Large ribosomal subunit protein bL36 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A9W6C6 8.11e-10 50 56 0 41 3 rpmJ Large ribosomal subunit protein bL36 Methylorubrum extorquens (strain PA1)
B7KQP2 8.11e-10 50 56 0 41 3 rpmJ Large ribosomal subunit protein bL36 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q13BA4 8.29e-10 50 60 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rhodopseudomonas palustris (strain BisB5)
B2IB44 1.02e-09 50 53 0 41 3 rpmJ Large ribosomal subunit protein bL36 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B8ISY7 1.16e-09 50 56 0 41 3 rpmJ Large ribosomal subunit protein bL36 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A5WGS5 1.22e-09 50 78 0 41 3 rpmJ Large ribosomal subunit protein bL36 Psychrobacter sp. (strain PRwf-1)
Q20ZC1 1.5e-09 49 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rhodopseudomonas palustris (strain BisB18)
Q5NN40 1.57e-09 49 56 0 41 3 rpmJ Large ribosomal subunit protein bL36 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q2J082 2.28e-09 49 58 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rhodopseudomonas palustris (strain HaA2)
B8ELV1 2.41e-09 49 53 0 41 3 rpmJ Large ribosomal subunit protein bL36 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B0ULQ6 2.41e-09 49 53 0 41 3 rpmJ Large ribosomal subunit protein bL36 Methylobacterium sp. (strain 4-46)
Q7MTN6 6.9e-09 48 63 0 33 3 rpmJ Large ribosomal subunit protein bL36 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RLW9 6.9e-09 48 63 0 33 3 rpmJ Large ribosomal subunit protein bL36 Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
A8ILY5 7.97e-09 47 53 0 41 3 rpmJ Large ribosomal subunit protein bL36 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q07J43 8.23e-09 47 56 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rhodopseudomonas palustris (strain BisA53)
B3QKS1 8.89e-09 47 56 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rhodopseudomonas palustris (strain TIE-1)
Q6N253 8.89e-09 47 56 0 41 1 rpmJ Large ribosomal subunit protein bL36 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q64NN1 9.6e-09 47 58 1 41 3 rpmJ Large ribosomal subunit protein bL36 Bacteroides fragilis (strain YCH46)
Q5L8D2 9.6e-09 47 58 1 41 3 rpmJ Large ribosomal subunit protein bL36 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A7IH13 1.52e-08 47 51 0 41 3 rpmJ Large ribosomal subunit protein bL36 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
P61173 3.45e-08 46 56 1 41 3 rpmJ Large ribosomal subunit protein bL36 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QGT4 3.45e-08 46 56 1 41 3 rpmJ Large ribosomal subunit protein bL36 Corynebacterium glutamicum (strain R)
P61174 3.45e-08 46 56 1 41 3 rpmJ Large ribosomal subunit protein bL36 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q6NFL5 3.97e-08 46 56 1 41 3 rpmJ Large ribosomal subunit protein bL36 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A4Z0W1 5.82e-08 45 56 0 41 3 rpmJ Large ribosomal subunit protein bL36 Bradyrhizobium sp. (strain ORS 278)
A5ECH2 5.82e-08 45 56 0 41 3 rpmJ Large ribosomal subunit protein bL36 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q89D92 5.82e-08 45 56 0 41 3 rpmJ Large ribosomal subunit protein bL36 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q4JX25 6.24e-08 45 56 1 41 3 rpmJ Large ribosomal subunit protein bL36 Corynebacterium jeikeium (strain K411)
B2GJB5 6.52e-08 45 58 1 41 3 rpmJ2 Large ribosomal subunit protein bL36B Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
A6W4N5 1.23e-07 45 56 1 41 3 rpmJ1 Large ribosomal subunit protein bL36A Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
A5FMZ9 1.53e-07 44 63 0 33 3 rpmJ Large ribosomal subunit protein bL36 Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
C0R2U2 2.45e-07 44 53 0 41 3 rpmJ Large ribosomal subunit protein bL36 Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73I40 2.45e-07 44 53 0 41 3 rpmJ Large ribosomal subunit protein bL36 Wolbachia pipientis wMel
B1VI61 2.69e-07 43 53 1 41 3 rpmJ Large ribosomal subunit protein bL36 Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
A1R8M6 2.9e-07 43 56 1 41 3 rpmJ1 Large ribosomal subunit protein bL36A Paenarthrobacter aurescens (strain TC1)
B3DVZ4 3.02e-07 43 57 0 33 3 rpmJ Large ribosomal subunit protein bL36 Methylacidiphilum infernorum (isolate V4)
B3CPU0 4.1e-07 43 51 0 41 3 rpmJ Large ribosomal subunit protein bL36 Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Q93JH3 4.26e-07 43 56 1 41 3 rpmJ2 Large ribosomal subunit protein bL36B Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A0K010 5.31e-07 43 56 1 41 3 rpmJ2 Large ribosomal subunit protein bL36B Arthrobacter sp. (strain FB24)
A9WMV4 6.62e-07 43 58 1 41 3 rpmJ1 Large ribosomal subunit protein bL36A Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
A8EYL5 7.86e-07 42 63 0 41 3 rpmJ Large ribosomal subunit protein bL36 Rickettsia canadensis (strain McKiel)
C4LJZ9 9.51e-07 42 51 1 41 3 rpmJ Large ribosomal subunit protein bL36 Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
A4FIM1 1.06e-06 42 51 1 41 3 rpmJ1 Large ribosomal subunit protein bL36A Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
C3PIQ3 1.15e-06 42 48 1 41 3 rpmJ Large ribosomal subunit protein bL36 Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q5GS04 1.18e-06 42 51 0 41 3 rpmJ Large ribosomal subunit protein bL36 Wolbachia sp. subsp. Brugia malayi (strain TRS)
A6LLN7 2.28e-06 41 54 0 33 3 rpmJ Large ribosomal subunit protein bL36 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
B3EUK0 2.72e-06 41 53 1 41 3 rpmJ Large ribosomal subunit protein bL36 Amoebophilus asiaticus (strain 5a2)
B3QYE6 3e-06 41 53 1 41 3 rpmJ Large ribosomal subunit protein bL36 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q46IS9 4.71e-06 40 58 1 41 3 rpmJ Large ribosomal subunit protein bL36 Prochlorococcus marinus (strain NATL2A)
B1LBL6 1.41e-05 39 54 0 33 3 rpmJ Large ribosomal subunit protein bL36 Thermotoga sp. (strain RQ2)
A5IMA7 1.41e-05 39 54 0 33 3 rpmJ Large ribosomal subunit protein bL36 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9X1I6 1.41e-05 39 54 0 33 3 rpmJ Large ribosomal subunit protein bL36 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q318K4 1.53e-05 39 56 1 41 3 rpmJ Large ribosomal subunit protein bL36 Prochlorococcus marinus (strain MIT 9312)
Q5FSY7 2.03e-05 39 63 0 41 3 rpmJ Large ribosomal subunit protein bL36 Gluconobacter oxydans (strain 621H)
O94690 2.29e-05 40 54 0 33 3 rtc6 Large ribosomal subunit protein bL36m Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A2BXC2 5e-05 38 53 1 41 3 rpmJ1 Large ribosomal subunit protein bL36A Prochlorococcus marinus (strain MIT 9515)
A7HM28 6.23e-05 38 48 0 33 3 rpmJ Large ribosomal subunit protein bL36 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
B4SBX0 8.02e-05 37 48 1 41 3 rpmJ Large ribosomal subunit protein bL36 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
B3QR94 8.02e-05 37 48 1 41 3 rpmJ Large ribosomal subunit protein bL36 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q3APJ6 8.02e-05 37 48 1 41 3 rpmJ Large ribosomal subunit protein bL36 Chlorobium chlorochromatii (strain CaD3)
Q03ED9 8.16e-05 37 46 1 41 3 rpmJ Large ribosomal subunit protein bL36 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A9BFZ4 0.000105 37 48 0 33 3 rpmJ Large ribosomal subunit protein bL36 Petrotoga mobilis (strain DSM 10674 / SJ95)
Q4FUD5 0.000127 37 57 0 26 3 rpmJ Large ribosomal subunit protein bL36 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1LWG3 0.00014 38 57 1 35 3 mrpl36 Large ribosomal subunit protein bL36m Danio rerio
P73300 0.00014 37 48 0 33 3 rpmJ Large ribosomal subunit protein bL36 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B3R014 0.000143 37 51 1 41 3 rpmJ Large ribosomal subunit protein bL36 Phytoplasma mali (strain AT)
Q035A6 0.000145 37 48 0 33 3 rpmJ Large ribosomal subunit protein bL36 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WAJ5 0.000145 37 48 0 33 3 rpmJ Large ribosomal subunit protein bL36 Lacticaseibacillus casei (strain BL23)
A8Z687 0.000175 37 44 0 38 3 rpmJ Large ribosomal subunit protein bL36 Karelsulcia muelleri (strain GWSS)
C1BJQ3 0.000175 38 54 0 33 2 mrpl36 Large ribosomal subunit protein bL36m Osmerus mordax
Q1QDG5 0.000204 36 53 0 26 3 rpmJ Large ribosomal subunit protein bL36 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A8F4T5 0.00022 36 42 0 33 3 rpmJ Large ribosomal subunit protein bL36 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
C5CGH8 0.000251 36 45 0 33 3 rpmJ Large ribosomal subunit protein bL36 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
B2G8V5 0.000282 36 51 0 33 3 rpmJ Large ribosomal subunit protein bL36 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLI2 0.000282 36 51 0 33 3 rpmJ Large ribosomal subunit protein bL36 Limosilactobacillus reuteri (strain DSM 20016)
Q839E1 0.000287 36 43 1 41 1 rpmJ Large ribosomal subunit protein bL36 Enterococcus faecalis (strain ATCC 700802 / V583)
B4S5A5 0.000309 36 46 1 41 3 rpmJ Large ribosomal subunit protein bL36 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A4SCT2 0.000309 36 46 1 41 3 rpmJ Large ribosomal subunit protein bL36 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B3EP38 0.000327 36 46 1 41 3 rpmJ Large ribosomal subunit protein bL36 Chlorobium phaeobacteroides (strain BS1)
O14464 0.00034 37 51 0 33 1 RTC6 Large ribosomal subunit protein bL36m Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B8E1F6 0.000351 36 53 2 41 3 rpmJ Large ribosomal subunit protein bL36 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
B5YDW6 0.000351 36 53 2 41 3 rpmJ Large ribosomal subunit protein bL36 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Q0VSI2 0.000373 36 53 0 26 3 rpmJ Large ribosomal subunit protein bL36 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q88XW3 0.000448 35 52 0 25 3 rpmJ Large ribosomal subunit protein bL36 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8KAJ4 0.000496 35 43 1 41 3 rpmJ Large ribosomal subunit protein bL36 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A1BJ11 0.000496 35 43 1 41 3 rpmJ Large ribosomal subunit protein bL36 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B3EGW7 0.000496 35 43 1 41 3 rpmJ Large ribosomal subunit protein bL36 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
B2RZ39 0.000497 37 55 0 27 3 Mrpl36 Large ribosomal subunit protein bL36m Rattus norvegicus
Q9P0J6 0.000557 37 56 0 30 1 MRPL36 Large ribosomal subunit protein bL36m Homo sapiens
Q74L67 0.000585 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q6YQZ8 0.000592 35 57 0 33 3 rpmJ Large ribosomal subunit protein bL36 Onion yellows phytoplasma (strain OY-M)
Q2NIX8 0.000592 35 57 0 33 3 rpmJ Large ribosomal subunit protein bL36 Aster yellows witches'-broom phytoplasma (strain AYWB)
Q6KI32 0.00066 35 53 0 26 3 rpmJ Large ribosomal subunit protein bL36 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
B2UEJ7 0.000697 35 46 1 41 3 rpmJ Large ribosomal subunit protein bL36 Ralstonia pickettii (strain 12J)
Q8XV34 0.000697 35 46 1 41 3 rpmJ Large ribosomal subunit protein bL36 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q03PY0 0.000702 35 52 0 25 3 rpmJ Large ribosomal subunit protein bL36 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q046A3 0.000713 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q19VB5 0.000765 35 61 1 26 3 rpl36 Large ribosomal subunit protein bL36c Chlorokybus atmophyticus
Q2JL77 0.000831 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Synechococcus sp. (strain JA-2-3B'a(2-13))
B9DSX3 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q03IH4 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M2D6 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXT4 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus thermophilus (strain CNRZ 1066)
C0ME28 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus equi subsp. zooepidemicus (strain H70)
B5XJ59 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE51 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VS6 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RC37 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J8Z0 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJ38 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JNZ4 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JE36 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66305 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XEB2 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE50 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66303 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M1
P66308 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B4U523 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M6X5 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus equi subsp. equi (strain 4047)
P66307 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66306 0.000841 35 56 0 25 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus agalactiae serotype III (strain NEM316)
Q1D752 0.000869 35 54 0 33 3 rpmJ Large ribosomal subunit protein bL36 Myxococcus xanthus (strain DK1622)
B1VAC4 0.000898 35 54 0 33 3 rpmJ Large ribosomal subunit protein bL36 Phytoplasma australiense

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_06795
Feature type CDS
Gene ykgO
Product type B 50S ribosomal protein L36
Location 172445 - 172570 (strand: -1)
Length 126 (nucleotides) / 41 (amino acids)
In genomic island -

Contig

Accession ZDB_683
Length 224720 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_977
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00444 Ribosomal protein L36

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0257 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L36

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02919 large subunit ribosomal protein L36 Ribosome -

Protein Sequence

MQVLSSLKSAKQRHPDCKIVRRRGRIYVICKSNPRFKAVQG

Flanking regions ( +/- flanking 50bp)

TTTGCCAAGCGCTTCGGGCGTTTTGTACATTAAAAGAAGAGGAAAAACCGATGCAGGTATTAAGTTCACTGAAAAGTGCGAAACAGCGTCATCCGGACTGTAAAATTGTCCGTCGTCGCGGTCGTATCTATGTGATTTGTAAGTCCAACCCGCGTTTTAAAGCCGTACAGGGGTGATTATGACAGCTAAATCAGTTCTCCCGTTACTGTTACTGGCGGGATTATTC