Homologs in group_2681

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04555 FBDBKF_04555 100.0 Morganella morganii S1 - Nuclear transport factor 2 family protein
EHELCC_05845 EHELCC_05845 100.0 Morganella morganii S2 - Nuclear transport factor 2 family protein
NLDBIP_06165 NLDBIP_06165 100.0 Morganella morganii S4 - Nuclear transport factor 2 family protein
LHKJJB_03045 LHKJJB_03045 100.0 Morganella morganii S3 - Nuclear transport factor 2 family protein
F4V73_RS09010 F4V73_RS09010 82.2 Morganella psychrotolerans - hypothetical protein

Distribution of the homologs in the orthogroup group_2681

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2681

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q10083 2.09e-12 62 33 0 100 4 SPAC11D3.04c Uncharacterized protein C11D3.04c Schizosaccharomyces pombe (strain 972 / ATCC 24843)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_06520
Feature type CDS
Gene -
Product Nuclear transport factor 2 family protein
Location 106298 - 106687 (strand: -1)
Length 390 (nucleotides) / 129 (amino acids)
In genomic island -

Contig

Accession ZDB_683
Length 224720 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2681
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF12680 SnoaL-like domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4922 General function prediction only (R) R Predicted SnoaL-like aldol condensation-catalyzing enzyme

Protein Sequence

MNKTEFVARALTDVLGEHIGDESLVEQYFSRDYVQVVNGQTIEFPAFLAHLNALKMATRSITIEIKSIAEGGSCVHTQHIAKAEKVSGEHAAFEVFACFRLADGKIVRCEEVTRQLTGDESDNDLGSRT

Flanking regions ( +/- flanking 50bp)

GGTTTCCGCTATGCTGTAAATGTGATCATAATAAAAAAGGATTTTCAGCAATGAATAAGACAGAGTTTGTAGCCCGCGCCCTGACTGACGTTCTCGGTGAACATATCGGTGATGAATCCCTGGTTGAACAGTATTTTTCCCGTGATTATGTTCAGGTGGTGAATGGTCAGACAATTGAGTTTCCCGCTTTTCTTGCCCATCTTAATGCCCTGAAAATGGCAACCCGCAGTATTACCATTGAGATAAAATCCATCGCAGAAGGCGGGTCCTGTGTGCACACACAGCATATCGCTAAGGCGGAAAAAGTCAGTGGCGAGCACGCCGCCTTTGAGGTTTTCGCCTGTTTCCGTCTGGCAGACGGTAAAATTGTCCGCTGTGAGGAAGTGACACGACAGCTGACCGGTGATGAGAGCGATAATGATCTGGGTTCCCGGACCTGATTTGTAACCTCAATGGTTTCTAAACGGAATAGTAATAGTCCTCGCCATAT