Homologs in group_951

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04535 FBDBKF_04535 100.0 Morganella morganii S1 yedE Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains
EHELCC_05825 EHELCC_05825 100.0 Morganella morganii S2 yedE Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains
NLDBIP_06145 NLDBIP_06145 100.0 Morganella morganii S4 yedE Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains
LHKJJB_03025 LHKJJB_03025 100.0 Morganella morganii S3 yedE Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains
F4V73_RS08990 F4V73_RS08990 83.1 Morganella psychrotolerans - YeeE/YedE thiosulfate transporter family protein
PMI_RS10360 PMI_RS10360 65.1 Proteus mirabilis HI4320 - YeeE/YedE thiosulfate transporter family protein

Distribution of the homologs in the orthogroup group_951

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_951

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q87AD4 4.23e-29 105 47 2 123 3 PD_1892 Probable transporter PD_1892 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PFB2 1.06e-28 104 47 2 123 2 XF_0766 Probable transporter XF_0766 Xylella fastidiosa (strain 9a5c)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_06500
Feature type CDS
Gene yedE
Product Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains
Location 103530 - 103940 (strand: -1)
Length 411 (nucleotides) / 136 (amino acids)
In genomic island -

Contig

Accession ZDB_683
Length 224720 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_951
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04143 Sulphur transport

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2391 General function prediction only (R) R Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07112 uncharacterized protein - -

Protein Sequence

MIIDSAAFTPVSAALGGLMIGIAVAVLLLFNGRIAGISGIFANMFTKQSGWRIAFIAGLAGAPWVYRLFAGQPDVVIAADYPLLIAAGLLVGFGTRLGNGCTSGHGICGMARLSKRSFAAVAVFMVSAFLTVWLMK

Flanking regions ( +/- flanking 50bp)

GCTCACCACGCTGTATCAGCTTTATTGTCCTGAAAAACAAGGAAAATAATATGATTATTGATAGCGCGGCTTTTACGCCGGTCAGTGCGGCACTGGGCGGACTGATGATCGGCATTGCGGTTGCTGTACTGTTACTGTTTAACGGGCGGATTGCCGGGATCAGCGGGATCTTCGCCAATATGTTCACAAAGCAGAGCGGCTGGCGGATAGCGTTTATTGCCGGGCTGGCAGGGGCACCGTGGGTTTACAGGTTGTTTGCCGGTCAGCCGGATGTGGTGATCGCTGCGGATTATCCGCTGCTGATCGCGGCTGGTCTGCTGGTCGGTTTCGGCACGCGGCTGGGTAACGGCTGTACCAGCGGACACGGTATCTGCGGTATGGCGCGGTTATCAAAACGATCATTTGCTGCCGTGGCGGTGTTTATGGTCAGTGCTTTTCTGACTGTCTGGCTGATGAAATAAGGACGTGCTATGCCTGTTATCACTGCATTAATCAGCGGAATTTTGTTCGG