Homologs in group_951

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04535 FBDBKF_04535 83.1 Morganella morganii S1 yedE Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains
EHELCC_05825 EHELCC_05825 83.1 Morganella morganii S2 yedE Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains
NLDBIP_06145 NLDBIP_06145 83.1 Morganella morganii S4 yedE Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains
LHKJJB_03025 LHKJJB_03025 83.1 Morganella morganii S3 yedE Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains
HKOGLL_06500 HKOGLL_06500 83.1 Morganella morganii S5 yedE Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains
PMI_RS10360 PMI_RS10360 64.3 Proteus mirabilis HI4320 - YeeE/YedE thiosulfate transporter family protein

Distribution of the homologs in the orthogroup group_951

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_951

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q87AD4 9.37e-31 110 50 2 123 3 PD_1892 Probable transporter PD_1892 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PFB2 6.37e-30 108 49 2 123 2 XF_0766 Probable transporter XF_0766 Xylella fastidiosa (strain 9a5c)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08990
Feature type CDS
Gene -
Product YeeE/YedE thiosulfate transporter family protein
Location 1878395 - 1878805 (strand: -1)
Length 411 (nucleotides) / 136 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_951
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04143 Sulphur transport

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2391 General function prediction only (R) R Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07112 uncharacterized protein - -

Protein Sequence

MSIDMAVFTPGSAALGGLVIGLAVSALLLLNGRIAGISGILANVFSPHSGWRIAFIAGLIISPWTYFLIQGQPDVVIAADYPLLIVAGLLVGFGTRLGSGCTSGHGICGMARLSKRSFAAVAVFMVSAFLTVWLMK

Flanking regions ( +/- flanking 50bp)

ACTGAATACCTTATATCAGCTTTATTGTCCGAAAAAAGAGGAGAAACAGGATGAGCATTGATATGGCGGTATTTACACCGGGAAGTGCGGCACTCGGCGGGTTGGTTATCGGCCTTGCTGTTTCTGCACTGCTCCTGCTGAACGGGCGGATTGCAGGAATCAGCGGTATTCTCGCCAATGTATTCTCACCGCACAGCGGCTGGCGGATAGCTTTTATTGCCGGGCTGATTATCTCCCCGTGGACTTATTTTTTGATTCAGGGACAGCCTGATGTGGTGATCGCGGCGGACTACCCGCTGCTTATTGTTGCCGGTTTGCTGGTCGGATTTGGTACACGCCTGGGCAGTGGTTGCACCAGCGGACACGGTATCTGCGGCATGGCAAGGCTGTCGAAGCGCTCTTTTGCGGCGGTCGCGGTATTTATGGTCAGTGCATTTCTGACGGTATGGTTAATGAAGTAAGGAGGCATTTATGCAGGTTATTTTTGCATTAATCAGCGGTGTATTATTCG