Homologs in group_854

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04320 FBDBKF_04320 100.0 Morganella morganii S1 ftsQ cell division protein FtsQ
EHELCC_05610 EHELCC_05610 100.0 Morganella morganii S2 ftsQ cell division protein FtsQ
NLDBIP_05930 NLDBIP_05930 100.0 Morganella morganii S4 ftsQ cell division protein FtsQ
LHKJJB_02810 LHKJJB_02810 100.0 Morganella morganii S3 ftsQ cell division protein FtsQ
F4V73_RS08765 F4V73_RS08765 90.9 Morganella psychrotolerans ftsQ cell division protein FtsQ
PMI_RS10185 PMI_RS10185 68.3 Proteus mirabilis HI4320 ftsQ cell division protein FtsQ

Distribution of the homologs in the orthogroup group_854

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_854

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CGB1 2.33e-126 363 64 1 261 3 ftsQ Cell division protein FtsQ Yersinia pestis
Q7CR81 5.08e-112 327 60 2 261 3 ftsQ Cell division protein FtsQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P06136 1.22e-107 315 61 3 262 1 ftsQ Cell division protein FtsQ Escherichia coli (strain K12)
Q32JZ9 2.58e-106 312 60 3 262 3 ftsQ Cell division protein FtsQ Shigella dysenteriae serotype 1 (strain Sd197)
Q7VQI6 9.18e-64 204 41 4 244 3 ftsQ Cell division protein FtsQ Blochmanniella floridana
Q5E2Q2 1.94e-63 202 41 3 230 3 ftsQ Cell division protein FtsQ Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9KPG9 9.68e-53 175 39 2 238 3 ftsQ Cell division protein FtsQ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8E9P9 1.91e-51 172 37 4 238 3 ftsQ Cell division protein FtsQ Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P45067 6.58e-46 157 35 2 224 3 ftsQ Cell division protein FtsQ Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B0BRI0 9.88e-46 156 34 1 227 3 ftsQ Cell division protein FtsQ Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q8PCJ7 1.94e-36 133 32 3 223 3 ftsQ Cell division protein FtsQ Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q83F15 7.45e-36 131 29 4 234 3 ftsQ Cell division protein FtsQ Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q5F6M1 9.28e-36 130 35 4 212 3 ftsQ Cell division protein FtsQ Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
D3SD88 8.8e-35 128 33 4 226 3 ftsQ Cell division protein FtsQ Thioalkalivibrio sp. (strain K90mix)
Q9K0X9 2.64e-34 127 34 4 211 3 ftsQ Cell division protein FtsQ Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q7VUQ6 1.4e-33 125 32 5 209 3 ftsQ Cell division protein FtsQ Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q2S9Z5 1.71e-30 118 29 5 229 3 ftsQ Cell division protein FtsQ Hahella chejuensis (strain KCTC 2396)
Q63QK0 4.66e-30 116 31 5 208 3 ftsQ Cell division protein FtsQ Burkholderia pseudomallei (strain K96243)
G3XDA7 4.94e-28 111 30 6 255 1 ftsQ Cell division protein FtsQ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2Y642 1.02e-27 109 28 4 230 3 ftsQ Cell division protein FtsQ Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q0VRZ9 1.04e-26 107 28 2 221 3 ftsQ Cell division protein FtsQ Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
F9ZZP5 1.22e-23 99 25 3 227 3 ftsQ Cell division protein FtsQ Methylomonas methanica (strain DSM 25384 / MC09)
B3PCL7 1.28e-23 100 27 3 198 3 ftsQ Cell division protein FtsQ Cellvibrio japonicus (strain Ueda107)
D3RVH9 2.52e-23 98 30 4 214 3 ftsQ Cell division protein FtsQ Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
D8JLE3 2.55e-18 85 24 4 237 3 ftsQ Cell division protein FtsQ Acinetobacter oleivorans (strain JCM 16667 / KCTC 23045 / DR1)
D6CRB4 3.26e-17 82 25 4 230 3 ftsQ Cell division protein FtsQ Thiomonas arsenitoxydans (strain DSM 22701 / CIP 110005 / 3As)
Q9X5H9 1.27e-11 67 28 7 206 3 ftsQ Cell division protein FtsQ Bartonella bacilliformis
Q1IKZ6 3.09e-09 60 27 11 238 3 ftsQ Cell division protein FtsQ Koribacter versatilis (strain Ellin345)
F8CLT8 3.47e-07 53 23 8 242 3 ftsQ Cell division protein FtsQ Myxococcus fulvus (strain ATCC BAA-855 / HW-1)
C6DZL0 3.43e-06 50 27 9 190 3 ftsQ Cell division protein FtsQ Geobacter sp. (strain M21)
Q3A2H0 3.7e-06 50 27 9 191 3 ftsQ Cell division protein FtsQ Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q2RVU8 8.3e-06 50 23 8 179 3 ftsQ Cell division protein FtsQ Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q748D9 1.48e-05 48 27 10 242 3 ftsQ Cell division protein FtsQ Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
O30993 7.35e-05 47 25 6 179 3 ftsQ Cell division protein FtsQ Rhizobium meliloti (strain 1021)
Q89FV1 0.00053 44 24 3 124 3 ftsQ Cell division protein FtsQ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_06285
Feature type CDS
Gene ftsQ
Product cell division protein FtsQ
Location 52243 - 53046 (strand: -1)
Length 804 (nucleotides) / 267 (amino acids)

Contig

Accession ZDB_683
Length 224720 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_854
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03799 Cell division protein FtsQ/DivIB, C-terminal
PF08478 POTRA domain, FtsQ-type

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1589 Cell cycle control, cell division, chromosome partitioning (D) D Cell division septal protein FtsQ

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03589 cell division protein FtsQ Cell cycle - Caulobacter -

Protein Sequence

MSQAALNMREPDPDSDYDGSRPSNGTYLAGLLFFLMVLGTLVWGGLMVLNWMKDADRLPMSKLVLTGERHYTTNDNVRKAVLSLGTPGTFMTLDVNEVQQQLERIPWLRQVTVRKQWPDELKIHLVEYVPYARWNDSQMVDDAGRVFSLPAELTEKDSFPMLYGAQGSEQDVLSGYREMAQQLSGAGLKIKSASMSPRHAWQLVLDNDVRVELGRLDTKGRLQRFIELYPTLTQEQDKRVDYVDLRYDSGAAVGWAPLQIDPFANGH

Flanking regions ( +/- flanking 50bp)

CATGAGCTTCTCCGCTTTTGTGGCGGACGTTCTGGCACTGGCGGACTGATATGTCACAGGCTGCACTGAATATGCGTGAACCGGATCCGGATTCGGATTATGACGGTTCACGTCCCAGTAACGGCACATACCTTGCCGGACTGCTGTTTTTCCTGATGGTGCTGGGAACGCTGGTCTGGGGGGGGCTGATGGTGCTGAACTGGATGAAAGATGCAGACCGCCTGCCGATGTCAAAACTGGTATTAACCGGTGAGCGCCATTACACGACAAACGATAATGTGCGCAAAGCGGTGTTATCCCTCGGGACGCCCGGCACGTTTATGACACTGGATGTCAATGAAGTACAGCAGCAGCTGGAACGGATCCCGTGGTTACGTCAGGTCACTGTGCGCAAGCAGTGGCCGGACGAATTAAAAATTCATCTGGTCGAGTATGTGCCGTATGCACGCTGGAATGACTCACAGATGGTTGATGACGCCGGGCGGGTTTTCAGCCTGCCGGCGGAACTGACAGAAAAAGATTCTTTCCCGATGCTCTACGGGGCACAGGGCAGTGAACAGGATGTACTGAGCGGGTATCGTGAAATGGCGCAGCAGCTCAGCGGGGCAGGGCTGAAAATCAAATCAGCTTCAATGTCACCGCGTCATGCCTGGCAGCTTGTGCTGGATAATGATGTCCGGGTTGAACTCGGACGGCTGGATACCAAAGGCCGGTTACAGCGTTTTATCGAACTGTATCCGACCCTGACGCAGGAACAGGACAAACGGGTTGATTATGTCGATCTCCGCTATGACAGCGGTGCTGCGGTCGGCTGGGCGCCATTGCAGATCGATCCTTTCGCAAACGGACATTAAGACATAACAGGTAAAGAAGGCGGGCAGAATAACAATGATCAAAGCAACGG