Homologs in group_923

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04320 FBDBKF_04320 90.9 Morganella morganii S1 ftsQ cell division protein FtsQ
EHELCC_05610 EHELCC_05610 90.9 Morganella morganii S2 ftsQ cell division protein FtsQ
NLDBIP_05930 NLDBIP_05930 90.9 Morganella morganii S4 ftsQ cell division protein FtsQ
LHKJJB_02810 LHKJJB_02810 90.9 Morganella morganii S3 ftsQ cell division protein FtsQ
HKOGLL_06285 HKOGLL_06285 90.9 Morganella morganii S5 ftsQ cell division protein FtsQ
PMI_RS10185 PMI_RS10185 68.7 Proteus mirabilis HI4320 ftsQ cell division protein FtsQ

Distribution of the homologs in the orthogroup group_923

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_923

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CGB1 2.65e-127 366 62 1 272 3 ftsQ Cell division protein FtsQ Yersinia pestis
Q7CR81 7.13e-113 329 61 1 259 3 ftsQ Cell division protein FtsQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P06136 1.18e-108 318 61 3 260 1 ftsQ Cell division protein FtsQ Escherichia coli (strain K12)
Q32JZ9 1.49e-107 316 61 3 260 3 ftsQ Cell division protein FtsQ Shigella dysenteriae serotype 1 (strain Sd197)
Q5E2Q2 6.37e-63 201 41 2 229 3 ftsQ Cell division protein FtsQ Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7VQI6 6.73e-60 194 39 4 244 3 ftsQ Cell division protein FtsQ Blochmanniella floridana
Q9KPG9 4.01e-53 176 40 2 238 3 ftsQ Cell division protein FtsQ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8E9P9 1.95e-50 169 38 4 238 3 ftsQ Cell division protein FtsQ Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B0BRI0 3.63e-46 157 36 1 227 3 ftsQ Cell division protein FtsQ Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
P45067 3.16e-45 156 37 4 225 3 ftsQ Cell division protein FtsQ Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q83F15 7.34e-37 134 31 3 220 3 ftsQ Cell division protein FtsQ Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q5F6M1 2.56e-34 127 32 4 228 3 ftsQ Cell division protein FtsQ Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q8PCJ7 4.12e-33 125 31 3 223 3 ftsQ Cell division protein FtsQ Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9K0X9 1.04e-32 123 31 4 227 3 ftsQ Cell division protein FtsQ Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
D3SD88 1.69e-32 122 32 4 226 3 ftsQ Cell division protein FtsQ Thioalkalivibrio sp. (strain K90mix)
Q7VUQ6 3.29e-32 122 31 5 209 3 ftsQ Cell division protein FtsQ Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q2S9Z5 3.7e-29 115 30 5 229 3 ftsQ Cell division protein FtsQ Hahella chejuensis (strain KCTC 2396)
Q63QK0 7.82e-29 113 30 4 207 3 ftsQ Cell division protein FtsQ Burkholderia pseudomallei (strain K96243)
Q2Y642 2.06e-26 106 29 6 230 3 ftsQ Cell division protein FtsQ Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
G3XDA7 7.54e-26 106 30 6 253 1 ftsQ Cell division protein FtsQ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q0VRZ9 2.16e-25 104 27 2 221 3 ftsQ Cell division protein FtsQ Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
F9ZZP5 2.81e-22 95 26 3 227 3 ftsQ Cell division protein FtsQ Methylomonas methanica (strain DSM 25384 / MC09)
B3PCL7 6.44e-21 93 23 3 237 3 ftsQ Cell division protein FtsQ Cellvibrio japonicus (strain Ueda107)
D3RVH9 4.31e-20 90 28 4 214 3 ftsQ Cell division protein FtsQ Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
D8JLE3 9.02e-19 87 23 4 262 3 ftsQ Cell division protein FtsQ Acinetobacter oleivorans (strain JCM 16667 / KCTC 23045 / DR1)
D6CRB4 2.23e-18 85 25 4 230 3 ftsQ Cell division protein FtsQ Thiomonas arsenitoxydans (strain DSM 22701 / CIP 110005 / 3As)
Q9X5H9 7.8e-12 67 29 7 204 3 ftsQ Cell division protein FtsQ Bartonella bacilliformis
Q1IKZ6 2.8e-09 60 29 12 236 3 ftsQ Cell division protein FtsQ Koribacter versatilis (strain Ellin345)
F8CLT8 3e-07 54 24 8 240 3 ftsQ Cell division protein FtsQ Myxococcus fulvus (strain ATCC BAA-855 / HW-1)
O30993 1.55e-05 49 25 6 179 3 ftsQ Cell division protein FtsQ Rhizobium meliloti (strain 1021)
Q2RVU8 1.95e-05 48 24 10 196 3 ftsQ Cell division protein FtsQ Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q3A2H0 2.95e-05 48 25 8 187 3 ftsQ Cell division protein FtsQ Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q748D9 3.06e-05 48 25 9 238 3 ftsQ Cell division protein FtsQ Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
C6DZL0 4.59e-05 47 25 8 197 3 ftsQ Cell division protein FtsQ Geobacter sp. (strain M21)
Q89FV1 0.000181 45 26 3 118 3 ftsQ Cell division protein FtsQ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A9CIB0 0.000236 45 24 6 175 3 ftsQ Cell division protein FtsQ Agrobacterium fabrum (strain C58 / ATCC 33970)
O30990 0.000456 43 24 6 175 3 ftsQ Cell division protein FtsQ (Fragment) Rhizobium radiobacter
Q92IT6 0.001 43 20 7 231 3 ftsQ Cell division protein FtsQ Rickettsia conorii (strain ATCC VR-613 / Malish 7)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08765
Feature type CDS
Gene ftsQ
Product cell division protein FtsQ
Location 1813405 - 1814256 (strand: -1)
Length 852 (nucleotides) / 283 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_923
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03799 Cell division protein FtsQ/DivIB, C-terminal
PF08478 POTRA domain, FtsQ-type

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1589 Cell cycle control, cell division, chromosome partitioning (D) D Cell division septal protein FtsQ

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03589 cell division protein FtsQ Cell cycle - Caulobacter -

Protein Sequence

MSQAALNMREPEPEFDGSRPSNGTYLSGLLFFLIVLGTLVWGGLMVLNWMKDADRLPMSKLVLTGERHYTKNDDVRKAVLSLGTPGTFMTLDVSEVQQQLERIPWLRQVTVRKQWPDELKIHLVEYVPYARWNDAQMIDDAGRVFSLPVQLTEKESFPMLYGAQGSEKDVLKGYREIAQQLAGAQLKLKSASMSPRHAWQLVLDNDIRVELGRLDTEGRLRRFIELYPTLTQVQDKRVDYVDLRYDSGAAVGWAPLQIDPFANGNQDFTGKEGRQNNNDKSNG

Flanking regions ( +/- flanking 50bp)

CATGAGTTTCTCCGTGTTTGTTGCCAACGTCCTGGCACTGGCGGACTGATATGTCACAGGCTGCACTGAATATGCGTGAACCGGAGCCGGAGTTCGACGGTTCACGTCCCAGTAACGGCACTTATCTCTCCGGCCTGTTGTTTTTCCTGATTGTATTGGGAACACTGGTCTGGGGCGGTCTGATGGTGCTGAACTGGATGAAAGATGCAGACCGTCTGCCTATGTCAAAACTGGTTTTAACCGGTGAGCGGCATTACACGAAAAATGATGATGTGCGCAAAGCGGTATTATCCCTCGGGACGCCCGGCACCTTCATGACACTGGATGTCAGTGAAGTGCAGCAGCAACTGGAGCGGATCCCGTGGTTACGTCAGGTGACTGTGCGTAAGCAGTGGCCTGACGAACTGAAAATACATCTGGTGGAGTATGTGCCTTATGCACGTTGGAACGACGCCCAGATGATAGATGACGCCGGACGGGTTTTCAGCCTGCCGGTGCAACTGACTGAAAAAGAATCCTTTCCCATGCTGTACGGGGCACAGGGCAGTGAAAAGGATGTATTGAAAGGGTATCGTGAGATAGCGCAGCAACTGGCGGGCGCGCAACTGAAGCTGAAATCAGCCTCAATGTCACCACGCCATGCCTGGCAGTTGGTTCTGGATAATGATATCCGGGTTGAACTGGGGCGCCTGGATACAGAAGGGCGGTTACGACGGTTTATTGAGCTGTATCCGACGCTGACCCAGGTTCAGGACAAACGGGTCGATTATGTCGATCTCCGCTATGACAGCGGCGCTGCGGTTGGCTGGGCACCATTACAGATCGATCCTTTCGCAAACGGAAATCAGGACTTTACAGGTAAAGAAGGCAGGCAGAATAACAATGATAAAAGCAACGGATAGAAAATTAGTCGTCGGCCTTGAAATAGGCACCGCCAAAGTATCTGCGCTTG