Homologs in group_1799

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13355 FBDBKF_13355 100.0 Morganella morganii S1 arnE 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE
EHELCC_08740 EHELCC_08740 100.0 Morganella morganii S2 arnE 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE
NLDBIP_09065 NLDBIP_09065 100.0 Morganella morganii S4 arnE 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE
LHKJJB_05200 LHKJJB_05200 100.0 Morganella morganii S3 arnE 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE
F4V73_RS03405 F4V73_RS03405 92.2 Morganella psychrotolerans arnE 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE
PMI_RS05095 PMI_RS05095 54.0 Proteus mirabilis HI4320 arnE 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE

Distribution of the homologs in the orthogroup group_1799

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1799

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4ETM0 1.44e-41 135 57 0 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Proteus mirabilis (strain HI4320)
Q7N3R0 1.06e-29 105 53 1 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JPL9 4.27e-28 102 58 0 107 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VBI6 4.94e-28 101 47 1 110 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C4K4T7 1e-27 100 53 1 109 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q2NRW0 1.17e-26 98 49 1 107 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Sodalis glossinidius (strain morsitans)
Q0T2M5 1.99e-26 97 48 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Shigella flexneri serotype 5b (strain 8401)
A8GDS0 3.13e-26 97 58 0 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Serratia proteamaculans (strain 568)
B1JJ33 4.04e-26 97 60 0 107 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4WAM0 2.39e-25 94 50 1 92 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Enterobacter sp. (strain 638)
Q3KCB8 3.77e-24 92 47 1 96 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Pseudomonas fluorescens (strain Pf0-1)
B4SYX4 1.05e-23 90 50 2 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Salmonella newport (strain SL254)
B4TPI5 1.32e-23 90 50 2 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Salmonella schwarzengrund (strain CVM19633)
A9N5A9 1.32e-23 90 50 2 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
O52328 1.53e-23 90 50 2 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5EZI1 1.53e-23 90 50 2 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Salmonella agona (strain SL483)
Q66A07 1.69e-23 90 61 0 98 2 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K5L0 1.69e-23 90 61 0 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FHH7 1.69e-23 90 61 0 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B4TBG9 1.94e-23 90 48 2 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Salmonella heidelberg (strain SL476)
C0Q066 3.27e-23 89 47 1 97 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Salmonella paratyphi C (strain RKS4594)
Q57M53 3.27e-23 89 47 1 97 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Salmonella choleraesuis (strain SC-B67)
A4TIM7 3.44e-23 89 61 0 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Yersinia pestis (strain Pestoides F)
Q1CII0 3.44e-23 89 61 0 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Yersinia pestis bv. Antiqua (strain Nepal516)
A9R090 3.44e-23 89 61 0 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Yersinia pestis bv. Antiqua (strain Angola)
Q74TF8 3.44e-23 89 61 0 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Yersinia pestis
Q1C745 3.44e-23 89 61 0 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Yersinia pestis bv. Antiqua (strain Antiqua)
B5RCC7 3.69e-23 89 50 2 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R275 3.69e-23 89 50 2 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Salmonella enteritidis PT4 (strain P125109)
B5FPE1 3.69e-23 89 50 2 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Salmonella dublin (strain CT_02021853)
P81891 4.25e-23 89 48 2 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Salmonella typhi
B5BCP3 4.25e-23 89 48 2 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Salmonella paratyphi A (strain AKU_12601)
Q5PNA9 4.25e-23 89 48 2 98 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q1R9F7 9.31e-23 88 50 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli (strain UTI89 / UPEC)
Q0TFI4 9.31e-23 88 50 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P0CB28 9.31e-23 88 50 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O1:K1 / APEC
B7MG25 9.31e-23 88 50 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O45:K1 (strain S88 / ExPEC)
Q8FFL8 1.61e-22 87 50 2 107 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7UFS0 1.61e-22 87 50 2 107 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q7UC61 2.04e-22 87 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Shigella flexneri
B5XTL2 2.58e-22 87 47 1 109 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Klebsiella pneumoniae (strain 342)
B7MXU0 3.02e-22 87 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O81 (strain ED1a)
B5YXQ1 3.19e-22 87 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4J8 3.19e-22 87 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O157:H7
P0CB31 3.37e-22 87 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Shigella sonnei (strain Ss046)
P0CB29 3.37e-22 87 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Shigella boydii serotype 4 (strain Sb227)
B2TW41 3.37e-22 87 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LLL2 3.37e-22 87 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli (strain SMS-3-5 / SECEC)
B6I7K1 3.37e-22 87 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli (strain SE11)
B7N5M3 3.37e-22 87 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q47377 3.37e-22 87 49 1 106 1 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli (strain K12)
B1IXS9 3.37e-22 87 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A2C5 3.37e-22 87 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O9:H4 (strain HS)
B1X8X1 3.37e-22 87 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli (strain K12 / DH10B)
B7M5U0 3.37e-22 87 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O8 (strain IAI1)
B7NNT7 3.37e-22 87 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A7ZP76 3.37e-22 87 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O139:H28 (strain E24377A / ETEC)
A6TF95 4.16e-22 86 47 1 109 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7LM73 6.61e-22 86 49 2 108 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7LAS3 7.21e-22 85 49 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli (strain 55989 / EAEC)
P0CB30 1.15e-21 85 48 1 106 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Shigella dysenteriae serotype 1 (strain Sd197)
A0KGY3 3.43e-21 84 47 1 94 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q4ZSY9 4.19e-21 84 49 3 101 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Pseudomonas syringae pv. syringae (strain B728a)
Q6D2F4 3.9e-20 81 53 1 107 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q4KC79 4.92e-18 76 48 1 96 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A4SQX2 4.08e-17 73 46 2 86 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Aeromonas salmonicida (strain A449)
C3KAC9 2.5e-16 72 50 1 96 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Pseudomonas fluorescens (strain SBW25)
A8FRQ9 2.21e-15 69 33 1 112 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Shewanella sediminis (strain HAW-EB3)
Q48HY8 4.24e-15 68 45 2 109 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q02R28 1.93e-11 59 47 1 101 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V1N7 2.15e-11 59 48 1 101 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Pseudomonas aeruginosa (strain PA7)
Q9HY60 6.48e-11 58 47 1 101 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7VBM9 6.48e-11 58 47 1 101 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Pseudomonas aeruginosa (strain LESB58)
Q3KCB7 0.000289 41 40 1 65 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Pseudomonas fluorescens (strain Pf0-1)
P55580 0.000303 40 28 1 69 4 NGR_a02340 Uncharacterized protein y4nH Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q6D2F5 0.000344 40 39 1 63 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A0KGY2 0.000346 40 38 2 78 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q7N3R1 0.000384 40 40 1 62 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GDS1 0.000577 40 37 2 79 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Serratia proteamaculans (strain 568)
Q4ZSY8 0.000664 40 39 1 63 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Pseudomonas syringae pv. syringae (strain B728a)
A4SQX3 0.000715 40 38 1 62 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Aeromonas salmonicida (strain A449)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_05715
Feature type CDS
Gene arnE
Product 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE
Location 211313 - 211663 (strand: 1)
Length 351 (nucleotides) / 116 (amino acids)

Contig

Accession ZDB_682
Length 259781 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1799
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00892 EamA-like transporter family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2076 Defense mechanisms (V) V Multidrug transporter EmrE and related cation transporters

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12962 undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnE Cationic antimicrobial peptide (CAMP) resistance -

Protein Sequence

MVFGQIVLLIIVSFLTCGGQICQKQAVDVWQAAQENAKRRGLYWLALAVFLLGLGMLLWLKLLQVMPLNIAYPMLSINFVVVTLVAQFLYGERVTRRHWCGVAAIVTGVILMGAGH

Flanking regions ( +/- flanking 50bp)

AAAACAGCCGGATGACCCTCTATATCTATGATAAACAGCCATAAGGTGTGATGGTGTTCGGGCAAATTGTTTTACTGATTATTGTCAGTTTTCTTACCTGCGGCGGCCAGATCTGCCAGAAACAGGCGGTGGATGTCTGGCAGGCGGCGCAGGAAAATGCAAAACGCAGAGGCCTGTACTGGCTGGCGCTGGCGGTGTTTCTGCTTGGCCTGGGGATGCTGCTGTGGCTGAAACTCCTGCAGGTGATGCCGCTGAATATCGCTTATCCGATGCTGAGTATCAACTTTGTGGTAGTCACCCTGGTGGCACAGTTTTTATACGGTGAGCGGGTGACCCGCAGACACTGGTGTGGCGTGGCAGCAATTGTCACCGGCGTGATTCTGATGGGAGCGGGACACTGATGCGCGGATATCTCTGGGTGCTCGGCAGTGTGCTGTTTGTCACCGCCGCT