Homologs in group_1959

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14295 FBDBKF_14295 100.0 Morganella morganii S1 - DUF3811 domain-containing protein
EHELCC_07985 EHELCC_07985 100.0 Morganella morganii S2 - DUF3811 domain-containing protein
NLDBIP_08310 NLDBIP_08310 100.0 Morganella morganii S4 - DUF3811 domain-containing protein
LHKJJB_05955 LHKJJB_05955 100.0 Morganella morganii S3 - DUF3811 domain-containing protein
F4V73_RS02610 F4V73_RS02610 79.8 Morganella psychrotolerans - DUF3811 domain-containing protein
PMI_RS06135 PMI_RS06135 63.2 Proteus mirabilis HI4320 - DUF3811 domain-containing protein

Distribution of the homologs in the orthogroup group_1959

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1959

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P32685 9.93e-11 55 40 1 89 4 yjbD Uncharacterized protein YjbD Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_04960
Feature type CDS
Gene -
Product DUF3811 domain-containing protein
Location 41844 - 42113 (strand: 1)
Length 270 (nucleotides) / 89 (amino acids)
In genomic island -

Contig

Accession ZDB_682
Length 259781 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1959
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF11656 YjbD family (DUF3811)

Protein Sequence

MKKLTIAEMTEPQKIRVRTRLAQEQKKLGRPLTNAEQNKVKDQIITEISKEVDAAAAKVRAQKKKDKIKPGGGEETFNWSAKTHTRGLR

Flanking regions ( +/- flanking 50bp)

GTCAGGGTATAACGGTACTGTTTATCCTTTTACTGCCACAGGGGTGATGAATGAAAAAGCTGACTATCGCAGAGATGACTGAGCCGCAGAAAATCCGTGTCCGCACCCGGCTGGCTCAGGAACAAAAGAAACTGGGGCGTCCGCTGACCAATGCGGAGCAGAATAAAGTCAAAGATCAGATTATCACCGAGATTTCCAAAGAAGTGGATGCCGCTGCCGCCAAAGTCCGGGCACAGAAAAAAAAGGATAAAATCAAACCCGGCGGCGGAGAAGAAACCTTTAACTGGTCAGCGAAAACCCATACGCGGGGATTGCGCTGAACCTTCCGGATAACTTACTTCCGTTTTTATTACGATAACCGCCACACGGC