Homologs in group_755

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03370 FBDBKF_03370 100.0 Morganella morganii S1 prmA 50S ribosomal protein L11 methyltransferase
EHELCC_07165 EHELCC_07165 100.0 Morganella morganii S2 prmA 50S ribosomal protein L11 methyltransferase
NLDBIP_07490 NLDBIP_07490 100.0 Morganella morganii S4 prmA 50S ribosomal protein L11 methyltransferase
LHKJJB_07025 LHKJJB_07025 100.0 Morganella morganii S3 prmA 50S ribosomal protein L11 methyltransferase
F4V73_RS11560 F4V73_RS11560 90.5 Morganella psychrotolerans prmA 50S ribosomal protein L11 methyltransferase
PMI_RS18030 PMI_RS18030 81.2 Proteus mirabilis HI4320 prmA 50S ribosomal protein L11 methyltransferase

Distribution of the homologs in the orthogroup group_755

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_755

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JRL5 8.99e-177 492 79 0 293 3 prmA Ribosomal protein L11 methyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JKF2 1.38e-175 489 79 0 293 3 prmA Ribosomal protein L11 methyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q8ZAX6 1.38e-175 489 79 0 293 3 prmA Ribosomal protein L11 methyltransferase Yersinia pestis
A7FDQ3 1.38e-175 489 79 0 293 3 prmA Ribosomal protein L11 methyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GK75 2.49e-175 488 79 0 293 3 prmA Ribosomal protein L11 methyltransferase Serratia proteamaculans (strain 568)
Q6DAJ5 1.88e-174 486 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q665E3 5.07e-174 485 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K467 5.07e-174 485 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B4EX23 2.54e-173 483 81 0 293 3 prmA Ribosomal protein L11 methyltransferase Proteus mirabilis (strain HI4320)
C6DIJ9 3.47e-173 483 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A8AQF7 8.17e-170 474 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q2NWP9 1.61e-168 471 75 0 293 3 prmA Ribosomal protein L11 methyltransferase Sodalis glossinidius (strain morsitans)
P60092 4.46e-168 470 80 0 292 3 prmA Ribosomal protein L11 methyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B2VL75 1.22e-167 469 79 0 293 3 prmA Ribosomal protein L11 methyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C5BEW8 4.92e-167 468 79 0 293 3 prmA Ribosomal protein L11 methyltransferase Edwardsiella ictaluri (strain 93-146)
Q65V70 9.45e-164 459 76 0 289 3 prmA Ribosomal protein L11 methyltransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6TES6 1.03e-163 459 79 0 293 3 prmA Ribosomal protein L11 methyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B4TJV7 2.5e-163 458 80 0 293 3 prmA Ribosomal protein L11 methyltransferase Salmonella heidelberg (strain SL476)
P67688 2.65e-163 458 80 0 293 3 prmA Ribosomal protein L11 methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67689 2.65e-163 458 80 0 293 3 prmA Ribosomal protein L11 methyltransferase Salmonella typhi
B4TX91 2.65e-163 458 80 0 293 3 prmA Ribosomal protein L11 methyltransferase Salmonella schwarzengrund (strain CVM19633)
B5BGT7 2.65e-163 458 80 0 293 3 prmA Ribosomal protein L11 methyltransferase Salmonella paratyphi A (strain AKU_12601)
Q5PJW5 2.65e-163 458 80 0 293 3 prmA Ribosomal protein L11 methyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5REY1 2.65e-163 458 80 0 293 3 prmA Ribosomal protein L11 methyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1C6 2.65e-163 458 80 0 293 3 prmA Ribosomal protein L11 methyltransferase Salmonella enteritidis PT4 (strain P125109)
Q57J85 2.65e-163 458 80 0 293 3 prmA Ribosomal protein L11 methyltransferase Salmonella choleraesuis (strain SC-B67)
B5F7P3 2.65e-163 458 80 0 293 3 prmA Ribosomal protein L11 methyltransferase Salmonella agona (strain SL483)
B4SUN8 3.72e-163 457 79 0 293 3 prmA Ribosomal protein L11 methyltransferase Salmonella newport (strain SL254)
A9MNA2 1.09e-162 456 79 0 293 3 prmA Ribosomal protein L11 methyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5FIW1 1.16e-162 456 80 0 293 3 prmA Ribosomal protein L11 methyltransferase Salmonella dublin (strain CT_02021853)
B5XND9 8.6e-161 452 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Klebsiella pneumoniae (strain 342)
A4WF74 1.96e-160 451 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Enterobacter sp. (strain 638)
B3GYL9 2.26e-160 451 75 0 293 3 prmA Ribosomal protein L11 methyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q7VPN5 3.95e-160 450 73 0 293 3 prmA Ribosomal protein L11 methyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B7LRN4 5.48e-160 450 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7NLI5 5.48e-160 450 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A3N2I5 8.68e-160 449 74 0 293 3 prmA Ribosomal protein L11 methyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B8F6T6 2.16e-159 448 73 0 293 3 prmA Ribosomal protein L11 methyltransferase Glaesserella parasuis serovar 5 (strain SH0165)
B1LGM4 3.09e-159 448 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B0BRD1 3.49e-159 447 74 0 293 3 prmA Ribosomal protein L11 methyltransferase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A6VM22 3.85e-159 447 75 0 289 3 prmA Ribosomal protein L11 methyltransferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P0A8T4 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Shigella flexneri
Q0T031 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Shigella flexneri serotype 5b (strain 8401)
Q32B79 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
Q31W09 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Shigella boydii serotype 4 (strain Sb227)
B2U2N5 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R669 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli (strain UTI89 / UPEC)
B6I1X9 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli (strain SE11)
B7NDN7 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8T1 4.25e-159 447 78 0 293 1 prmA Ribosomal protein L11 methyltransferase Escherichia coli (strain K12)
B1IQ33 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8T2 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCJ7 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGF9 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli O1:K1 / APEC
A8A570 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli O9:H4 (strain HS)
B1XHM8 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli (strain K12 / DH10B)
C4ZSZ5 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B5YSY4 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8T3 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli O157:H7
B7MC29 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJZ0 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSF3 4.25e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7N0Q3 7.04e-159 447 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli O81 (strain ED1a)
B7LHW6 1.48e-158 446 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli (strain 55989 / EAEC)
Q3YWZ0 4.68e-158 445 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Shigella sonnei (strain Ss046)
Q9CLW2 5.28e-158 445 73 0 289 3 prmA Ribosomal protein L11 methyltransferase Pasteurella multocida (strain Pm70)
B7M0X1 5.83e-158 444 78 0 293 3 prmA Ribosomal protein L11 methyltransferase Escherichia coli O8 (strain IAI1)
Q0I1Y6 2.01e-157 443 73 0 289 3 prmA Ribosomal protein L11 methyltransferase Histophilus somni (strain 129Pt)
A7MXI3 2.28e-157 443 70 1 295 3 prmA Ribosomal protein L11 methyltransferase Vibrio campbellii (strain ATCC BAA-1116)
Q87KU2 3.35e-157 442 70 1 295 3 prmA Ribosomal protein L11 methyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q4QLT2 4.3e-157 442 72 0 293 3 prmA Ribosomal protein L11 methyltransferase Haemophilus influenzae (strain 86-028NP)
B0UV84 4.36e-157 442 73 0 289 3 prmA Ribosomal protein L11 methyltransferase Histophilus somni (strain 2336)
P60094 8.49e-157 442 70 1 295 3 prmA Ribosomal protein L11 methyltransferase Vibrio vulnificus (strain YJ016)
A5UIB7 1.93e-156 441 73 0 289 3 prmA Ribosomal protein L11 methyltransferase Haemophilus influenzae (strain PittGG)
A5UD93 1.93e-156 441 73 0 289 3 prmA Ribosomal protein L11 methyltransferase Haemophilus influenzae (strain PittEE)
Q8DD03 3.81e-156 440 70 1 295 3 prmA Ribosomal protein L11 methyltransferase Vibrio vulnificus (strain CMCP6)
Q6LLY5 6.78e-156 439 71 1 293 3 prmA Ribosomal protein L11 methyltransferase Photobacterium profundum (strain SS9)
Q9KV64 8.19e-156 439 70 1 295 3 prmA Ribosomal protein L11 methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LQP9 9.14e-156 439 70 1 295 3 prmA Ribosomal protein L11 methyltransferase Vibrio cholerae serotype O1 (strain M66-2)
B6ENA3 2.47e-155 438 69 1 294 3 prmA Ribosomal protein L11 methyltransferase Aliivibrio salmonicida (strain LFI1238)
A5F3S3 3.12e-155 438 70 1 295 3 prmA Ribosomal protein L11 methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B5FC65 1.83e-154 436 70 1 294 3 prmA Ribosomal protein L11 methyltransferase Aliivibrio fischeri (strain MJ11)
Q5E263 1.83e-154 436 70 1 294 3 prmA Ribosomal protein L11 methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B7VM52 1.39e-152 431 69 1 295 3 prmA Ribosomal protein L11 methyltransferase Vibrio atlanticus (strain LGP32)
P44402 1.91e-148 421 70 1 290 3 prmA Ribosomal protein L11 methyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A6WTE5 6.42e-143 406 66 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella baltica (strain OS185)
A0KNJ1 1.28e-142 405 65 1 294 3 prmA Ribosomal protein L11 methyltransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B8E680 4.36e-142 404 65 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella baltica (strain OS223)
A3D9J5 5.93e-142 404 65 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A1RFA3 1.13e-141 403 65 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella sp. (strain W3-18-1)
A4YB19 1.13e-141 403 65 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9L5E5 1.79e-141 403 65 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella baltica (strain OS195)
Q0HQK1 3.69e-141 402 64 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella sp. (strain MR-7)
Q0HN86 3.69e-141 402 64 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella sp. (strain MR-4)
A0KS74 3.69e-141 402 64 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella sp. (strain ANA-3)
Q8EJR7 7.11e-141 401 64 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A4SJL7 1.04e-139 398 64 1 294 3 prmA Ribosomal protein L11 methyltransferase Aeromonas salmonicida (strain A449)
C4LAF1 5.13e-137 391 61 1 294 3 prmA Ribosomal protein L11 methyltransferase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B8CHY3 9.6e-137 391 62 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q12S38 9.15e-136 388 64 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A8G0U8 1.62e-135 388 62 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella sediminis (strain HAW-EB3)
B1KQE8 1.11e-134 385 61 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella woodyi (strain ATCC 51908 / MS32)
C4K4P6 3.87e-134 385 63 1 300 3 prmA Ribosomal protein L11 methyltransferase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q3IIC0 1.08e-133 383 61 1 294 3 prmA Ribosomal protein L11 methyltransferase Pseudoalteromonas translucida (strain TAC 125)
B0TJ37 9.68e-132 378 64 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella halifaxensis (strain HAW-EB4)
Q15ZR4 6.77e-131 376 59 1 293 3 prmA Ribosomal protein L11 methyltransferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q088J8 3.9e-130 374 60 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella frigidimarina (strain NCIMB 400)
A1SAM0 1.03e-129 373 63 0 294 3 prmA Ribosomal protein L11 methyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8GZI2 1.12e-129 373 62 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q489G6 8.39e-128 368 61 2 294 3 prmA Ribosomal protein L11 methyltransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A3Q9Q5 2.27e-125 362 61 0 293 3 prmA Ribosomal protein L11 methyltransferase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B4S130 1.1e-123 358 59 1 293 3 prmA Ribosomal protein L11 methyltransferase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A6VZL5 1.66e-116 340 56 4 297 3 prmA Ribosomal protein L11 methyltransferase Marinomonas sp. (strain MWYL1)
Q5QVT9 3.3e-115 336 54 1 294 3 prmA Ribosomal protein L11 methyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A4XQ64 8.61e-110 322 61 4 295 3 prmA Ribosomal protein L11 methyltransferase Pseudomonas mendocina (strain ymp)
Q1I4C5 4.95e-108 318 59 4 295 3 prmA Ribosomal protein L11 methyltransferase Pseudomonas entomophila (strain L48)
B1J5U4 6.5e-107 315 59 4 295 3 prmA Ribosomal protein L11 methyltransferase Pseudomonas putida (strain W619)
B0KJZ2 1.61e-106 314 58 4 295 3 prmA Ribosomal protein L11 methyltransferase Pseudomonas putida (strain GB-1)
A5W9K3 3.98e-106 313 58 4 295 3 prmA Ribosomal protein L11 methyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88DK7 4.69e-106 313 58 4 295 3 prmA Ribosomal protein L11 methyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A6VCV6 1.92e-105 311 58 3 295 3 prmA Ribosomal protein L11 methyltransferase Pseudomonas aeruginosa (strain PA7)
Q4ZN40 4.12e-105 310 58 4 295 3 prmA Ribosomal protein L11 methyltransferase Pseudomonas syringae pv. syringae (strain B728a)
B3PBH5 6.66e-105 310 52 4 296 3 prmA Ribosomal protein L11 methyltransferase Cellvibrio japonicus (strain Ueda107)
Q9HUW3 8.66e-105 310 57 3 295 3 prmA Ribosomal protein L11 methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02FH0 8.66e-105 310 57 3 295 3 prmA Ribosomal protein L11 methyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V1R2 8.66e-105 310 57 3 295 3 prmA Ribosomal protein L11 methyltransferase Pseudomonas aeruginosa (strain LESB58)
C3K6W5 9.03e-105 310 58 4 296 3 prmA Ribosomal protein L11 methyltransferase Pseudomonas fluorescens (strain SBW25)
Q48DI0 2.05e-104 309 57 4 295 3 prmA Ribosomal protein L11 methyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1QV72 4.77e-104 308 54 5 297 3 prmA Ribosomal protein L11 methyltransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q4KIX1 1.63e-103 306 58 4 296 3 prmA Ribosomal protein L11 methyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q87VS3 9.03e-103 305 57 4 295 3 prmA Ribosomal protein L11 methyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3KIP5 1.59e-102 304 57 4 295 3 prmA Ribosomal protein L11 methyltransferase Pseudomonas fluorescens (strain Pf0-1)
C5BP64 1.53e-101 302 50 3 295 3 prmA Ribosomal protein L11 methyltransferase Teredinibacter turnerae (strain ATCC 39867 / T7901)
C1DLJ6 2.68e-100 298 57 3 294 3 prmA Ribosomal protein L11 methyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q2S9L7 5.63e-100 298 53 2 292 3 prmA Ribosomal protein L11 methyltransferase Hahella chejuensis (strain KCTC 2396)
A1U698 1.39e-97 291 52 4 297 3 prmA Ribosomal protein L11 methyltransferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q21MK7 1.08e-93 281 47 4 295 3 prmA Ribosomal protein L11 methyltransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q31II5 2.81e-92 278 51 4 296 3 prmA Ribosomal protein L11 methyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3JC88 7.09e-92 277 47 3 294 3 prmA Ribosomal protein L11 methyltransferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B0VLL0 2.72e-84 258 45 5 307 3 prmA Ribosomal protein L11 methyltransferase Acinetobacter baumannii (strain SDF)
B0V7H8 3.9e-84 258 45 5 307 3 prmA Ribosomal protein L11 methyltransferase Acinetobacter baumannii (strain AYE)
A3M6R7 3.9e-84 258 45 5 307 3 prmA Ribosomal protein L11 methyltransferase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B7IC17 3.9e-84 258 45 5 307 3 prmA Ribosomal protein L11 methyltransferase Acinetobacter baumannii (strain AB0057)
B7H0I7 3.9e-84 258 45 5 307 3 prmA Ribosomal protein L11 methyltransferase Acinetobacter baumannii (strain AB307-0294)
A5WFX2 3.65e-79 245 41 4 310 3 prmA Ribosomal protein L11 methyltransferase Psychrobacter sp. (strain PRwf-1)
Q4FRP0 2.41e-78 243 41 4 308 3 prmA Ribosomal protein L11 methyltransferase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1QA78 3.92e-78 243 42 4 308 3 prmA Ribosomal protein L11 methyltransferase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q9JXW2 1.75e-77 240 46 7 300 3 prmA Ribosomal protein L11 methyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P60091 2.44e-77 240 44 5 300 3 prmA Ribosomal protein L11 methyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A1KS36 1.77e-76 238 46 7 300 3 prmA Ribosomal protein L11 methyltransferase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q60A25 8.11e-76 236 45 4 294 3 prmA Ribosomal protein L11 methyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q6F9P9 9.7e-76 236 44 5 305 3 prmA Ribosomal protein L11 methyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A5IHD3 1.63e-75 235 43 4 294 3 prmA Ribosomal protein L11 methyltransferase Legionella pneumophila (strain Corby)
Q9JW08 2.82e-75 235 46 7 300 3 prmA Ribosomal protein L11 methyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
C1DCV9 2.93e-75 235 43 4 300 3 prmA Ribosomal protein L11 methyltransferase Laribacter hongkongensis (strain HLHK9)
Q5X7S8 4.07e-75 234 43 5 295 3 prmA Ribosomal protein L11 methyltransferase Legionella pneumophila (strain Paris)
Q5FAH7 4.95e-75 234 45 5 299 3 prmA Ribosomal protein L11 methyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q3SMB4 9.48e-75 233 43 4 302 3 prmA Ribosomal protein L11 methyltransferase Thiobacillus denitrificans (strain ATCC 25259)
Q5WZ79 4.53e-74 231 44 5 295 3 prmA Ribosomal protein L11 methyltransferase Legionella pneumophila (strain Lens)
Q5ZYB1 9.78e-74 231 44 5 295 3 prmA Ribosomal protein L11 methyltransferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q0AB25 3.93e-73 229 43 4 299 3 prmA Ribosomal protein L11 methyltransferase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q8PQ06 2.76e-72 228 43 6 308 3 prmA Ribosomal protein L11 methyltransferase Xanthomonas axonopodis pv. citri (strain 306)
Q1LIT8 3.22e-70 222 45 5 288 3 prmA Ribosomal protein L11 methyltransferase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B1JVC0 8.44e-70 221 41 4 300 3 prmA Ribosomal protein L11 methyltransferase Burkholderia orbicola (strain MC0-3)
Q39JS9 1.12e-69 221 41 4 300 3 prmA Ribosomal protein L11 methyltransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4E5V2 2.12e-69 220 41 4 300 3 prmA Ribosomal protein L11 methyltransferase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q1BZC1 2.39e-69 220 41 4 300 3 prmA Ribosomal protein L11 methyltransferase Burkholderia orbicola (strain AU 1054)
A0K4C9 2.39e-69 220 41 4 300 3 prmA Ribosomal protein L11 methyltransferase Burkholderia cenocepacia (strain HI2424)
A1WYK5 1.09e-68 218 43 4 294 3 prmA Ribosomal protein L11 methyltransferase Halorhodospira halophila (strain DSM 244 / SL1)
Q2SZE1 1.44e-68 218 44 4 286 3 prmA Ribosomal protein L11 methyltransferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A1V0M1 1.75e-68 218 43 4 286 3 prmA Ribosomal protein L11 methyltransferase Burkholderia mallei (strain SAVP1)
Q62GX2 1.75e-68 218 43 4 286 3 prmA Ribosomal protein L11 methyltransferase Burkholderia mallei (strain ATCC 23344)
A2S5P8 1.75e-68 218 43 4 286 3 prmA Ribosomal protein L11 methyltransferase Burkholderia mallei (strain NCTC 10229)
A3MRB1 1.75e-68 218 43 4 286 3 prmA Ribosomal protein L11 methyltransferase Burkholderia mallei (strain NCTC 10247)
B1YSW5 3.04e-68 217 41 4 300 3 prmA Ribosomal protein L11 methyltransferase Burkholderia ambifaria (strain MC40-6)
A3NDQ7 3.39e-68 217 43 4 286 3 prmA Ribosomal protein L11 methyltransferase Burkholderia pseudomallei (strain 668)
Q3JNI0 3.39e-68 217 43 4 286 3 prmA Ribosomal protein L11 methyltransferase Burkholderia pseudomallei (strain 1710b)
Q63QN9 3.5e-68 217 43 4 286 3 prmA Ribosomal protein L11 methyltransferase Burkholderia pseudomallei (strain K96243)
A9AI41 3.61e-68 217 41 4 300 3 prmA Ribosomal protein L11 methyltransferase Burkholderia multivorans (strain ATCC 17616 / 249)
Q0BIF9 4.34e-68 216 41 4 300 3 prmA Ribosomal protein L11 methyltransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q478R6 4.53e-68 216 42 3 298 3 prmA Ribosomal protein L11 methyltransferase Dechloromonas aromatica (strain RCB)
B2UCS1 4.87e-68 216 42 5 299 3 prmA Ribosomal protein L11 methyltransferase Ralstonia pickettii (strain 12J)
Q2P856 5.61e-68 217 41 6 308 3 prmA Ribosomal protein L11 methyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2JH19 8.68e-68 216 41 4 300 3 prmA Ribosomal protein L11 methyltransferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A4JBD7 1.01e-67 216 40 4 300 3 prmA Ribosomal protein L11 methyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
A4G8P4 1.22e-67 216 41 5 299 3 prmA Ribosomal protein L11 methyltransferase Herminiimonas arsenicoxydans
A6T2B6 6.32e-67 214 42 5 299 3 prmA Ribosomal protein L11 methyltransferase Janthinobacterium sp. (strain Marseille)
Q1GX86 9.21e-67 213 40 5 299 3 prmA Ribosomal protein L11 methyltransferase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B3R6K3 1.18e-66 213 44 4 288 3 prmA Ribosomal protein L11 methyltransferase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q81ZZ9 1.57e-66 213 40 6 313 3 prmA Ribosomal protein L11 methyltransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q13U36 1.6e-66 213 42 4 286 3 prmA Ribosomal protein L11 methyltransferase Paraburkholderia xenovorans (strain LB400)
Q0AEV2 1.99e-66 213 39 4 308 3 prmA Ribosomal protein L11 methyltransferase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q0K6X3 2.51e-66 212 44 3 285 3 prmA Ribosomal protein L11 methyltransferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q46XA5 2.62e-66 212 44 4 288 3 prmA Ribosomal protein L11 methyltransferase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q3BY72 4.72e-66 211 43 6 308 3 prmA Ribosomal protein L11 methyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B2SYT3 1.94e-65 210 41 4 286 3 prmA Ribosomal protein L11 methyltransferase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q8PD33 3.41e-64 207 41 4 306 3 prmA Ribosomal protein L11 methyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UZB8 3.41e-64 207 41 4 306 3 prmA Ribosomal protein L11 methyltransferase Xanthomonas campestris pv. campestris (strain 8004)
Q8XVP2 1.4e-63 205 42 5 299 3 prmA Ribosomal protein L11 methyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A5EVX5 2.37e-63 204 38 4 292 3 prmA Ribosomal protein L11 methyltransferase Dichelobacter nodosus (strain VCS1703A)
B1XT48 1.57e-59 196 39 9 312 3 prmA Ribosomal protein L11 methyltransferase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q9PBE3 1.39e-57 190 43 6 307 3 prmA Ribosomal protein L11 methyltransferase Xylella fastidiosa (strain 9a5c)
Q7WF92 2.81e-57 189 40 8 309 3 prmA Ribosomal protein L11 methyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W3W2 5.25e-57 188 40 8 309 3 prmA Ribosomal protein L11 methyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
B2FJP0 1.3e-54 182 42 4 307 3 prmA Ribosomal protein L11 methyltransferase Stenotrophomonas maltophilia (strain K279a)
B4SL82 3.69e-54 181 43 4 306 3 prmA Ribosomal protein L11 methyltransferase Stenotrophomonas maltophilia (strain R551-3)
Q87C45 9.96e-53 177 45 6 286 3 prmA Ribosomal protein L11 methyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0KA79 1.07e-49 169 30 6 309 3 prmA Ribosomal protein L11 methyltransferase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B0K3X8 2.49e-48 166 30 6 309 3 prmA Ribosomal protein L11 methyltransferase Thermoanaerobacter sp. (strain X514)
Q12EI9 1.57e-47 164 35 5 285 3 prmA Ribosomal protein L11 methyltransferase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q67S51 9.7e-45 156 41 3 209 3 prmA Ribosomal protein L11 methyltransferase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B1KZN5 3.4e-44 155 32 7 306 3 prmA Ribosomal protein L11 methyltransferase Clostridium botulinum (strain Loch Maree / Type A3)
A7GHH4 4.68e-44 155 32 7 306 3 prmA Ribosomal protein L11 methyltransferase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1ILM1 4.68e-44 155 32 7 306 3 prmA Ribosomal protein L11 methyltransferase Clostridium botulinum (strain Okra / Type B1)
C1FVT8 4.94e-44 155 32 7 306 3 prmA Ribosomal protein L11 methyltransferase Clostridium botulinum (strain Kyoto / Type A2)
A5I638 4.94e-44 155 32 7 306 3 prmA Ribosomal protein L11 methyltransferase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FXL3 4.94e-44 155 32 7 306 3 prmA Ribosomal protein L11 methyltransferase Clostridium botulinum (strain ATCC 19397 / Type A)
Q8RB66 5.26e-44 155 31 6 313 3 prmA Ribosomal protein L11 methyltransferase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A1AT86 7.94e-43 152 35 9 299 3 prmA Ribosomal protein L11 methyltransferase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
C3L3G5 1.11e-42 151 31 5 305 3 prmA Ribosomal protein L11 methyltransferase Clostridium botulinum (strain 657 / Type Ba4)
Q0AWM5 4.65e-42 149 37 3 210 3 prmA Ribosomal protein L11 methyltransferase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
C4L423 7.38e-42 149 32 6 314 3 prmA Ribosomal protein L11 methyltransferase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A0LQ64 4.37e-41 147 32 5 297 3 prmA Ribosomal protein L11 methyltransferase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A4J7F1 5.48e-41 147 36 3 209 3 prmA Ribosomal protein L11 methyltransferase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q74G05 1.34e-40 145 39 6 246 3 prmA Ribosomal protein L11 methyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q39Q76 2.68e-40 145 42 4 201 3 prmA Ribosomal protein L11 methyltransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B7GKD0 5.59e-40 144 31 9 315 3 prmA Ribosomal protein L11 methyltransferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q65H56 5.75e-40 144 31 9 316 3 prmA Ribosomal protein L11 methyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B8I303 1.23e-39 144 30 6 289 3 prmA Ribosomal protein L11 methyltransferase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q5WHF9 1.57e-39 143 31 9 316 3 prmA Ribosomal protein L11 methyltransferase Shouchella clausii (strain KSM-K16)
A0Q1R2 1.61e-39 143 30 5 308 3 prmA Ribosomal protein L11 methyltransferase Clostridium novyi (strain NT)
P45558 2.03e-39 143 30 6 308 2 prmA Ribosomal protein L11 methyltransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9KD70 4.18e-39 142 31 8 309 3 prmA Ribosomal protein L11 methyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
C0ZB50 5.01e-39 142 32 10 316 3 prmA Ribosomal protein L11 methyltransferase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B1YKT1 5.3e-39 142 30 8 318 3 prmA Ribosomal protein L11 methyltransferase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q7VAM5 8.88e-39 141 42 3 191 3 prmA Ribosomal protein L11 methyltransferase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
B5YDR3 1.06e-38 140 34 8 244 3 prmA Ribosomal protein L11 methyltransferase Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
A3DF23 1.98e-38 140 30 8 309 3 prmA Ribosomal protein L11 methyltransferase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B8HPZ1 2.05e-38 140 36 5 212 3 prmA Ribosomal protein L11 methyltransferase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q820A9 2.18e-38 140 30 7 317 3 prmA Ribosomal protein L11 methyltransferase Enterococcus faecalis (strain ATCC 700802 / V583)
B5E9X4 2.36e-38 140 40 3 210 3 prmA Ribosomal protein L11 methyltransferase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
P54460 2.98e-38 140 31 9 317 3 prmA Ribosomal protein L11 methyltransferase Bacillus subtilis (strain 168)
Q2RKY6 5.44e-38 139 31 7 313 3 prmA Ribosomal protein L11 methyltransferase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A8FFD0 5.49e-38 139 31 9 316 3 prmA Ribosomal protein L11 methyltransferase Bacillus pumilus (strain SAFR-032)
Q49Y20 7.47e-38 139 30 7 313 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q892R2 1.28e-37 138 29 5 306 3 prmA Ribosomal protein L11 methyltransferase Clostridium tetani (strain Massachusetts / E88)
C6DY35 2.1e-37 137 40 4 210 3 prmA Ribosomal protein L11 methyltransferase Geobacter sp. (strain M21)
A8MG53 2.24e-37 137 30 10 318 3 prmA Ribosomal protein L11 methyltransferase Alkaliphilus oremlandii (strain OhILAs)
Q5KWZ9 2.26e-37 137 31 8 312 3 prmA Ribosomal protein L11 methyltransferase Geobacillus kaustophilus (strain HTA426)
A7Z6V9 3.87e-37 137 31 9 317 3 prmA Ribosomal protein L11 methyltransferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q5MZ45 3.95e-37 136 38 4 214 3 prmA Ribosomal protein L11 methyltransferase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31N39 3.95e-37 136 38 4 214 3 prmA Ribosomal protein L11 methyltransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8DM00 4.26e-37 136 40 5 210 3 prmA Ribosomal protein L11 methyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A4IR29 4.4e-37 137 30 6 317 3 prmA Ribosomal protein L11 methyltransferase Geobacillus thermodenitrificans (strain NG80-2)
A7GT06 4.45e-37 137 30 8 315 3 prmA Ribosomal protein L11 methyltransferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
C4ZAZ2 4.95e-37 137 39 6 219 3 prmA Ribosomal protein L11 methyltransferase Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q8EPW5 1.19e-36 135 31 10 316 3 prmA Ribosomal protein L11 methyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A6TSL8 1.4e-36 135 29 8 318 3 prmA Ribosomal protein L11 methyltransferase Alkaliphilus metalliredigens (strain QYMF)
A6LRN8 2.05e-36 135 33 4 250 3 prmA Ribosomal protein L11 methyltransferase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q03F44 2.15e-36 135 30 8 314 3 prmA Ribosomal protein L11 methyltransferase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B8DE40 2.48e-36 135 30 8 316 3 prmA Ribosomal protein L11 methyltransferase Listeria monocytogenes serotype 4a (strain HCC23)
C4Z0Q0 2.77e-36 135 36 8 244 3 prmA Ribosomal protein L11 methyltransferase Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
C1KVB8 2.88e-36 135 30 8 316 3 prmA Ribosomal protein L11 methyltransferase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q92BP0 4.62e-36 134 29 9 318 3 prmA Ribosomal protein L11 methyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P0DJO9 4.92e-36 134 29 9 318 3 prmA Ribosomal protein L11 methyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
G2K044 4.92e-36 134 29 9 318 3 prmA Ribosomal protein L11 methyltransferase Listeria monocytogenes serotype 1/2a (strain 10403S)
B9LZ49 1.42e-35 133 32 6 311 3 prmA Ribosomal protein L11 methyltransferase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q71ZJ9 1.67e-35 132 29 9 318 3 prmA Ribosomal protein L11 methyltransferase Listeria monocytogenes serotype 4b (strain F2365)
Q038Q5 2.02e-35 132 32 5 297 3 prmA Ribosomal protein L11 methyltransferase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
A0AIS2 2.46e-35 132 29 8 316 3 prmA Ribosomal protein L11 methyltransferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B9LFP4 2.66e-35 132 39 3 197 3 prmA Ribosomal protein L11 methyltransferase Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WD89 2.66e-35 132 39 3 197 3 prmA Ribosomal protein L11 methyltransferase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A9KKT8 3.01e-35 132 31 12 334 3 prmA Ribosomal protein L11 methyltransferase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q0SRE9 3.63e-35 132 35 4 228 3 prmA Ribosomal protein L11 methyltransferase Clostridium perfringens (strain SM101 / Type A)
Q8XIT6 3.63e-35 132 35 4 228 3 prmA Ribosomal protein L11 methyltransferase Clostridium perfringens (strain 13 / Type A)
B7HPL1 4.29e-35 131 29 9 314 3 prmA Ribosomal protein L11 methyltransferase Bacillus cereus (strain AH187)
Q6HDK9 5.29e-35 131 29 9 314 3 prmA Ribosomal protein L11 methyltransferase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q634M9 5.29e-35 131 29 9 314 3 prmA Ribosomal protein L11 methyltransferase Bacillus cereus (strain ZK / E33L)
C1ESK6 5.29e-35 131 29 9 314 3 prmA Ribosomal protein L11 methyltransferase Bacillus cereus (strain 03BB102)
B7JN37 5.29e-35 131 29 9 314 3 prmA Ribosomal protein L11 methyltransferase Bacillus cereus (strain AH820)
Q81LS4 5.29e-35 131 29 9 314 3 prmA Ribosomal protein L11 methyltransferase Bacillus anthracis
A0RIT1 5.29e-35 131 29 9 314 3 prmA Ribosomal protein L11 methyltransferase Bacillus thuringiensis (strain Al Hakam)
C3L5R5 5.29e-35 131 29 9 314 3 prmA Ribosomal protein L11 methyltransferase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P8L8 5.29e-35 131 29 9 314 3 prmA Ribosomal protein L11 methyltransferase Bacillus anthracis (strain A0248)
Q0TNT3 5.29e-35 131 35 4 228 3 prmA Ribosomal protein L11 methyltransferase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B9IY79 5.57e-35 131 29 9 314 3 prmA Ribosomal protein L11 methyltransferase Bacillus cereus (strain Q1)
B3WEN7 5.82e-35 131 33 7 298 3 prmA Ribosomal protein L11 methyltransferase Lacticaseibacillus casei (strain BL23)
A5G9G5 6.54e-35 131 36 3 223 3 prmA Ribosomal protein L11 methyltransferase Geotalea uraniireducens (strain Rf4)
B9E6W9 6.59e-35 131 33 10 305 3 prmA Ribosomal protein L11 methyltransferase Macrococcus caseolyticus (strain JCSC5402)
B7IYG5 7.4e-35 131 29 9 314 3 prmA Ribosomal protein L11 methyltransferase Bacillus cereus (strain G9842)
Q818F1 8.14e-35 131 29 9 314 3 prmA Ribosomal protein L11 methyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HCT8 8.14e-35 131 29 9 314 3 prmA Ribosomal protein L11 methyltransferase Bacillus cereus (strain B4264)
A9B5V4 9.76e-35 131 36 5 230 3 prmA Ribosomal protein L11 methyltransferase Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q1DD74 9.85e-35 130 34 11 284 3 prmA Ribosomal protein L11 methyltransferase Myxococcus xanthus (strain DK1622)
Q7NIP7 1.47e-34 130 37 8 237 3 prmA Ribosomal protein L11 methyltransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q730M3 1.48e-34 130 29 9 314 3 prmA Ribosomal protein L11 methyltransferase Bacillus cereus (strain ATCC 10987 / NRS 248)
B2GBW2 1.5e-34 130 32 7 317 3 prmA Ribosomal protein L11 methyltransferase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
A5GV37 2.67e-34 129 39 4 209 3 prmA Ribosomal protein L11 methyltransferase Synechococcus sp. (strain RCC307)
Q24SS5 2.81e-34 129 32 8 313 3 prmA Ribosomal protein L11 methyltransferase Desulfitobacterium hafniense (strain Y51)
Q2YT49 5.67e-34 129 36 4 198 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
B7KJ88 6.44e-34 128 33 7 265 3 prmA Ribosomal protein L11 methyltransferase Gloeothece citriformis (strain PCC 7424)
B8FUN2 8.72e-34 128 31 8 313 3 prmA Ribosomal protein L11 methyltransferase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q4L6S8 9.28e-34 128 29 8 312 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus haemolyticus (strain JCSC1435)
B1MZ55 1.04e-33 127 29 7 294 3 prmA Ribosomal protein L11 methyltransferase Leuconostoc citreum (strain KM20)
B8E1A7 1.09e-33 127 30 8 290 3 prmA Ribosomal protein L11 methyltransferase Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q6GGC2 1.14e-33 128 36 4 198 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus aureus (strain MRSA252)
B9DNJ8 1.18e-33 128 29 8 312 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus carnosus (strain TM300)
Q7TU56 1.25e-33 127 36 4 212 3 prmA Ribosomal protein L11 methyltransferase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
B7K2J4 1.29e-33 127 38 5 215 3 prmA Ribosomal protein L11 methyltransferase Rippkaea orientalis (strain PCC 8801 / RF-1)
A2BY60 1.33e-33 127 30 8 303 3 prmA Ribosomal protein L11 methyltransferase Prochlorococcus marinus (strain MIT 9515)
P0A0P5 1.41e-33 127 36 4 198 2 prmA Ribosomal protein L11 methyltransferase Staphylococcus aureus
P0A0P4 1.41e-33 127 36 4 198 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus aureus (strain N315)
P0A0P3 1.41e-33 127 36 4 198 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ITA6 1.41e-33 127 36 4 198 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus aureus (strain JH9)
A6U250 1.41e-33 127 36 4 198 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus aureus (strain JH1)
A7X2X9 1.41e-33 127 36 4 198 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
A5D3Y3 1.5e-33 127 31 6 298 3 prmA Ribosomal protein L11 methyltransferase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A8ZW25 1.63e-33 127 35 6 251 3 prmA Ribosomal protein L11 methyltransferase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q8NWB0 1.82e-33 127 36 4 198 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus aureus (strain MW2)
A8Z4B7 1.82e-33 127 36 4 198 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G8Y9 1.82e-33 127 36 4 198 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus aureus (strain MSSA476)
A6QHC1 1.82e-33 127 36 4 198 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus aureus (strain Newman)
Q2FXZ4 1.82e-33 127 36 4 198 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FGE5 1.82e-33 127 36 4 198 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus aureus (strain USA300)
Q5HFI2 2.08e-33 127 36 4 198 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus aureus (strain COL)
Q03SF4 2.56e-33 127 30 6 313 3 prmA Ribosomal protein L11 methyltransferase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B0JX03 3.24e-33 126 35 7 236 3 prmA Ribosomal protein L11 methyltransferase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q7TUS7 3.57e-33 126 36 7 248 3 prmA Ribosomal protein L11 methyltransferase Prochlorococcus marinus (strain MIT 9313)
Q38XP2 3.97e-33 126 32 9 285 3 prmA Ribosomal protein L11 methyltransferase Latilactobacillus sakei subsp. sakei (strain 23K)
C0QLV7 7.77e-33 125 38 4 218 3 prmA Ribosomal protein L11 methyltransferase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B1WNQ4 9.97e-33 125 35 6 234 3 prmA Ribosomal protein L11 methyltransferase Crocosphaera subtropica (strain ATCC 51142 / BH68)
B2USL4 1.95e-32 125 33 6 236 3 prmA Ribosomal protein L11 methyltransferase Helicobacter pylori (strain Shi470)
Q48R70 2.93e-32 124 31 6 306 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q10X25 3.32e-32 124 38 9 210 3 prmA Ribosomal protein L11 methyltransferase Trichodesmium erythraeum (strain IMS101)
Q99XW8 4.4e-32 124 31 7 306 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pyogenes serotype M1
B9DTA9 4.88e-32 124 38 2 177 3 prmA Ribosomal protein L11 methyltransferase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
P0DD19 4.99e-32 124 32 6 282 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DD18 4.99e-32 124 32 6 282 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
A6QBN7 6.86e-32 122 37 6 208 3 prmA Ribosomal protein L11 methyltransferase Sulfurovum sp. (strain NBC37-1)
B9KDE1 6.88e-32 122 34 8 243 3 prmA Ribosomal protein L11 methyltransferase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
B9MJY9 7.07e-32 123 28 8 310 3 prmA Ribosomal protein L11 methyltransferase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q1JET3 9.72e-32 123 31 7 306 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pyogenes serotype M2 (strain MGAS10270)
B4U5A5 1.11e-31 122 38 2 184 3 prmA Ribosomal protein L11 methyltransferase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M9U4 1.11e-31 122 38 2 184 3 prmA Ribosomal protein L11 methyltransferase Streptococcus equi subsp. equi (strain 4047)
Q8NZ98 1.26e-31 122 32 6 282 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q17WN8 1.5e-31 122 35 6 218 3 prmA Ribosomal protein L11 methyltransferase Helicobacter acinonychis (strain Sheeba)
Q1JJU1 1.59e-31 122 31 7 306 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J9P3 1.59e-31 122 31 7 306 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pyogenes serotype M12 (strain MGAS2096)
B5XIN3 1.98e-31 122 32 6 282 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pyogenes serotype M49 (strain NZ131)
Q39ZZ2 2.09e-31 122 35 6 280 3 prmA Ribosomal protein L11 methyltransferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B0TAD9 2.15e-31 122 36 3 208 3 prmA Ribosomal protein L11 methyltransferase Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A5N6M4 2.16e-31 122 28 5 306 3 prmA Ribosomal protein L11 methyltransferase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E043 2.16e-31 122 28 5 306 3 prmA Ribosomal protein L11 methyltransferase Clostridium kluyveri (strain NBRC 12016)
B2ISD7 2.67e-31 122 32 6 272 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pneumoniae (strain CGSP14)
Q8DNP4 2.73e-31 122 32 6 272 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04J12 2.73e-31 122 32 6 272 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
C0MF82 2.87e-31 121 38 2 184 3 prmA Ribosomal protein L11 methyltransferase Streptococcus equi subsp. zooepidemicus (strain H70)
A2RGK2 3.85e-31 121 32 6 282 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pyogenes serotype M5 (strain Manfredo)
C1CT24 4.32e-31 121 32 4 269 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pneumoniae (strain Taiwan19F-14)
A4XKA6 4.69e-31 120 34 6 226 3 prmA Ribosomal protein L11 methyltransferase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B1ZUS4 4.74e-31 120 32 6 278 3 prmA Ribosomal protein L11 methyltransferase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
Q5X9S8 4.89e-31 121 32 6 282 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
C1CMA0 5e-31 121 31 6 272 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pneumoniae (strain P1031)
B8ZMW2 5.49e-31 120 32 6 272 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q97P62 5.96e-31 120 32 6 272 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
C1CG04 7.19e-31 120 32 6 272 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pneumoniae (strain JJA)
Q9ZM65 8e-31 120 32 6 234 3 prmA Ribosomal protein L11 methyltransferase Helicobacter pylori (strain J99 / ATCC 700824)
B1I7P5 8.5e-31 120 32 5 270 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pneumoniae (strain Hungary19A-6)
P73820 9.64e-31 120 34 5 212 3 prmA Ribosomal protein L11 methyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B2J397 1.09e-30 120 34 7 229 3 prmA Ribosomal protein L11 methyltransferase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q8DS02 1.44e-30 120 30 6 283 3 prmA Ribosomal protein L11 methyltransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A3PEI7 1.51e-30 119 29 6 299 3 prmA Ribosomal protein L11 methyltransferase Prochlorococcus marinus (strain MIT 9301)
B2G6X4 1.68e-30 119 30 8 315 3 prmA Ribosomal protein L11 methyltransferase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJF8 1.68e-30 119 30 8 315 3 prmA Ribosomal protein L11 methyltransferase Limosilactobacillus reuteri (strain DSM 20016)
A2C717 1.94e-30 119 40 3 183 3 prmA Ribosomal protein L11 methyltransferase Prochlorococcus marinus (strain MIT 9303)
O07678 3.12e-30 119 32 6 234 3 prmA Ribosomal protein L11 methyltransferase Helicobacter pylori (strain ATCC 700392 / 26695)
Q88VP9 3.15e-30 119 29 6 313 3 prmA Ribosomal protein L11 methyltransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q5M6B7 3.49e-30 119 31 4 274 3 prmA Ribosomal protein L11 methyltransferase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1S5 3.49e-30 119 31 4 274 3 prmA Ribosomal protein L11 methyltransferase Streptococcus thermophilus (strain CNRZ 1066)
Q8CSC7 4.6e-30 118 31 3 207 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNW8 4.6e-30 118 31 3 207 3 prmA Ribosomal protein L11 methyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q1J4K0 6.44e-30 118 31 6 282 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pyogenes serotype M4 (strain MGAS10750)
B8FBE9 6.71e-30 118 34 5 216 3 prmA Ribosomal protein L11 methyltransferase Desulfatibacillum aliphaticivorans
Q1CUC6 7.2e-30 118 32 6 234 3 prmA Ribosomal protein L11 methyltransferase Helicobacter pylori (strain HPAG1)
O67870 7.52e-30 116 35 6 207 3 prmA Ribosomal protein L11 methyltransferase Aquifex aeolicus (strain VF5)
Q8R6G7 1.37e-29 117 32 6 243 3 prmA Ribosomal protein L11 methyltransferase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8YVT3 2.18e-29 116 33 5 223 3 prmA Ribosomal protein L11 methyltransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3JYX9 2.33e-29 116 32 6 275 3 prmA Ribosomal protein L11 methyltransferase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q03MQ4 2.72e-29 116 31 4 274 3 prmA Ribosomal protein L11 methyltransferase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q7VHY7 3.12e-29 116 32 7 240 3 prmA Ribosomal protein L11 methyltransferase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q5FKI8 4.23e-29 115 30 9 278 3 prmA Ribosomal protein L11 methyltransferase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q319D4 4.72e-29 115 28 9 306 3 prmA Ribosomal protein L11 methyltransferase Prochlorococcus marinus (strain MIT 9312)
A7ZES6 5.02e-29 114 34 7 231 3 prmA Ribosomal protein L11 methyltransferase Campylobacter concisus (strain 13826)
Q6AQF1 6.47e-29 115 33 4 211 3 prmA Ribosomal protein L11 methyltransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B1XKZ0 7.28e-29 115 37 6 213 3 prmA Ribosomal protein L11 methyltransferase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A8YUZ6 7.87e-29 115 32 6 255 3 prmA Ribosomal protein L11 methyltransferase Lactobacillus helveticus (strain DPC 4571)
C1C922 1.01e-28 115 32 5 270 3 prmA Ribosomal protein L11 methyltransferase Streptococcus pneumoniae (strain 70585)
Q9CJ97 1.07e-28 115 30 9 308 3 prmA Ribosomal protein L11 methyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
B3E5Z5 1.15e-28 114 34 6 278 3 prmA Ribosomal protein L11 methyltransferase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q3M6M1 1.43e-28 114 34 7 225 3 prmA Ribosomal protein L11 methyltransferase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B2V2I9 1.52e-28 114 34 4 230 3 prmA Ribosomal protein L11 methyltransferase Clostridium botulinum (strain Alaska E43 / Type E3)
Q8DX85 1.95e-28 114 31 6 275 3 prmA Ribosomal protein L11 methyltransferase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E307 1.95e-28 114 31 6 275 3 prmA Ribosomal protein L11 methyltransferase Streptococcus agalactiae serotype III (strain NEM316)
B2TM01 3.36e-28 113 35 4 227 3 prmA Ribosomal protein L11 methyltransferase Clostridium botulinum (strain Eklund 17B / Type B)
Q033A6 6.73e-28 112 31 8 285 3 prmA Ribosomal protein L11 methyltransferase Lactococcus lactis subsp. cremoris (strain SK11)
Q1GAH2 8.59e-28 112 32 5 252 3 prmA Ribosomal protein L11 methyltransferase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q04AV7 1.17e-27 112 32 5 252 1 prmA Ribosomal protein L11 methyltransferase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q043X8 1.66e-27 111 34 4 212 3 prmA Ribosomal protein L11 methyltransferase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
B1L841 1.94e-27 110 33 6 213 3 prmA Ribosomal protein L11 methyltransferase Thermotoga sp. (strain RQ2)
Q74IX0 2.19e-27 111 35 3 194 3 prmA Ribosomal protein L11 methyltransferase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A2RHI1 2.25e-27 111 30 8 285 3 prmA Ribosomal protein L11 methyltransferase Lactococcus lactis subsp. cremoris (strain MG1363)
A5IN97 3.27e-27 109 31 4 210 3 prmA Ribosomal protein L11 methyltransferase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
A2BSS6 3.62e-27 110 28 8 305 3 prmA Ribosomal protein L11 methyltransferase Prochlorococcus marinus (strain AS9601)
B9JH32 3.81e-27 110 34 8 250 3 prmA Ribosomal protein L11 methyltransferase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q9X0G8 3.98e-27 109 32 4 210 3 prmA Ribosomal protein L11 methyltransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q3AF06 7.99e-27 109 37 3 155 3 prmA Ribosomal protein L11 methyltransferase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
O86951 9.54e-27 108 31 4 198 3 prmA Ribosomal protein L11 methyltransferase Thermotoga neapolitana
A8G6G4 2.29e-26 108 26 8 305 3 prmA Ribosomal protein L11 methyltransferase Prochlorococcus marinus (strain MIT 9215)
B2IH12 2.84e-26 108 32 6 277 3 prmA Ribosomal protein L11 methyltransferase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q8FZQ6 2.98e-26 107 34 2 191 3 prmA Ribosomal protein L11 methyltransferase Brucella suis biovar 1 (strain 1330)
Q8YI53 2.98e-26 107 34 2 191 3 prmA Ribosomal protein L11 methyltransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RE56 2.98e-26 107 34 2 191 3 prmA Ribosomal protein L11 methyltransferase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M676 2.98e-26 107 34 2 191 3 prmA Ribosomal protein L11 methyltransferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57C92 2.98e-26 107 34 2 191 3 prmA Ribosomal protein L11 methyltransferase Brucella abortus biovar 1 (strain 9-941)
Q2YPS7 2.98e-26 107 34 2 191 3 prmA Ribosomal protein L11 methyltransferase Brucella abortus (strain 2308)
B2S6P1 2.98e-26 107 34 2 191 3 prmA Ribosomal protein L11 methyltransferase Brucella abortus (strain S19)
B0CHK5 3.27e-26 107 34 2 191 3 prmA Ribosomal protein L11 methyltransferase Brucella suis (strain ATCC 23445 / NCTC 10510)
Q92NN5 4.7e-26 107 37 2 190 3 prmA Ribosomal protein L11 methyltransferase Rhizobium meliloti (strain 1021)
Q2K6E0 6.39e-26 107 31 4 277 3 prmA Ribosomal protein L11 methyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
C3MEL0 8.2e-26 106 38 2 190 3 prmA Ribosomal protein L11 methyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P60095 8.47e-26 106 34 5 211 3 prmA Ribosomal protein L11 methyltransferase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B9K9N3 1.57e-25 105 31 4 202 3 prmA Ribosomal protein L11 methyltransferase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
B5ZWH3 1.65e-25 105 35 2 190 3 prmA Ribosomal protein L11 methyltransferase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B9JXT0 3.01e-25 105 33 4 227 3 prmA Ribosomal protein L11 methyltransferase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A6Q4V8 5.93e-25 103 34 5 207 3 prmA Ribosomal protein L11 methyltransferase Nitratiruptor sp. (strain SB155-2)
A9ER52 6.18e-25 104 34 6 261 3 prmA Ribosomal protein L11 methyltransferase Sorangium cellulosum (strain So ce56)
Q9RU72 6.99e-25 103 35 6 245 3 prmA Ribosomal protein L11 methyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A6L2N4 1.12e-24 103 34 5 202 3 prmA Ribosomal protein L11 methyltransferase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q64VV4 1.92e-24 102 34 4 205 3 prmA Ribosomal protein L11 methyltransferase Bacteroides fragilis (strain YCH46)
Q5LEW2 1.92e-24 102 34 4 205 3 prmA Ribosomal protein L11 methyltransferase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A6LJG3 2.23e-24 102 31 5 215 3 prmA Ribosomal protein L11 methyltransferase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q8UDP9 2.34e-24 102 34 3 191 3 prmA Ribosomal protein L11 methyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q5HTY7 5.52e-24 101 32 6 206 3 prmA Ribosomal protein L11 methyltransferase Campylobacter jejuni (strain RM1221)
B3PTU0 1.12e-23 100 29 4 277 3 prmA Ribosomal protein L11 methyltransferase Rhizobium etli (strain CIAT 652)
A7H2P1 1.28e-23 100 32 5 199 3 prmA Ribosomal protein L11 methyltransferase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q1ME53 1.32e-23 100 34 2 190 3 prmA Ribosomal protein L11 methyltransferase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A0RQL1 1.37e-23 100 34 8 210 3 prmA Ribosomal protein L11 methyltransferase Campylobacter fetus subsp. fetus (strain 82-40)
Q9PNH7 1.66e-23 100 32 6 206 3 prmA Ribosomal protein L11 methyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A1W0A4 2.5e-23 99 32 6 206 3 prmA Ribosomal protein L11 methyltransferase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q7TTX0 2.6e-23 99 35 7 245 3 prmA Ribosomal protein L11 methyltransferase Parasynechococcus marenigrum (strain WH8102)
A8FMH0 2.85e-23 99 32 6 206 3 prmA Ribosomal protein L11 methyltransferase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A7I0N5 1.21e-22 98 30 7 227 3 prmA Ribosomal protein L11 methyltransferase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
B0T1G7 1.76e-22 97 34 5 212 3 prmA Ribosomal protein L11 methyltransferase Caulobacter sp. (strain K31)
Q89FW1 3.22e-22 97 33 2 192 3 prmA Ribosomal protein L11 methyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q133Y8 3.53e-22 97 33 3 192 3 prmA Ribosomal protein L11 methyltransferase Rhodopseudomonas palustris (strain BisB5)
Q9A838 3.74e-22 96 34 5 212 3 prmA Ribosomal protein L11 methyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8F6B7 8.11e-22 95 31 5 194 3 prmA Ribosomal protein L11 methyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PX0 8.11e-22 95 31 5 194 3 prmA Ribosomal protein L11 methyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q84BQ9 1.64e-21 94 35 5 210 1 prmA Ribosomal protein L11 methyltransferase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P60093 1.78e-21 95 35 5 194 3 prmA Ribosomal protein L11 methyltransferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B7IFP7 1.87e-21 94 33 6 184 3 prmA Ribosomal protein L11 methyltransferase Thermosipho africanus (strain TCF52B)
Q04Z65 2.35e-21 94 32 4 167 3 prmA Ribosomal protein L11 methyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04QV8 2.35e-21 94 32 4 167 3 prmA Ribosomal protein L11 methyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q2S4C3 5.15e-21 93 36 4 187 3 prmA Ribosomal protein L11 methyltransferase Salinibacter ruber (strain DSM 13855 / M31)
B3QLQ8 7.01e-21 93 33 5 175 3 prmA Ribosomal protein L11 methyltransferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q8AAZ8 1.35e-19 89 35 1 148 3 prmA Ribosomal protein L11 methyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q98KD0 4.53e-19 88 32 5 227 3 prmA Ribosomal protein L11 methyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q11GT9 8.6e-19 87 29 3 213 3 prmA Ribosomal protein L11 methyltransferase Chelativorans sp. (strain BNC1)
Q8KG70 1.08e-17 84 32 5 174 3 prmA Ribosomal protein L11 methyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q1J043 9.04e-17 81 37 6 217 3 prmA Ribosomal protein L11 methyltransferase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q57732 1.6e-08 57 39 3 96 4 MJ0284 Uncharacterized protein MJ0284 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q58338 2.25e-07 53 37 1 62 3 MJ0928 Putative protein N5-glutamine methyltransferase MJ0928 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A9M0C4 5.15e-07 53 42 1 68 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup C (strain 053442)
Q9JWE6 8.79e-07 52 42 1 68 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JXI7 9.56e-07 52 42 1 68 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P38074 1.15e-06 52 47 1 53 1 HMT1 Protein arginine N-methyltransferase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O13648 1.54e-06 52 30 2 105 1 rmt3 Ribosomal protein arginine N-methyltransferase rmt3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9WYV8 6.56e-06 50 33 1 75 1 prmC Release factor glutamine methyltransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q52892 9.18e-06 50 40 1 60 4 noeA Nodulation protein NoeA Rhizobium meliloti (strain 1021)
B0V4Z1 4.3e-05 48 29 4 129 3 rsmC Ribosomal RNA small subunit methyltransferase C Acinetobacter baumannii (strain AYE)
B7GWT8 4.3e-05 48 29 4 129 3 rsmC Ribosomal RNA small subunit methyltransferase C Acinetobacter baumannii (strain AB307-0294)
Q8ZZA9 6.36e-05 46 39 2 58 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q08A71 7.57e-05 47 39 1 56 2 PRMT6 Probable protein arginine N-methyltransferase 6 Arabidopsis thaliana
A3MWC5 0.00013 45 35 3 68 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
Q8K1A0 0.000138 45 44 0 47 1 Mettl5 rRNA N6-adenosine-methyltransferase METTL5 Mus musculus
Q9NRN9 0.000178 45 44 0 47 1 METTL5 rRNA N6-adenosine-methyltransferase METTL5 Homo sapiens
A3BMN9 0.000212 46 40 0 49 2 PRMT3 Probable protein arginine N-methyltransferase 3 Oryza sativa subsp. japonica
Q46Y42 0.00022 45 38 2 67 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q6MAY1 0.00023 45 30 2 84 3 pc1544 Uncharacterized RNA methyltransferase pc1544 Protochlamydia amoebophila (strain UWE25)
A3MZ07 0.000242 45 45 1 51 3 ubiG Ubiquinone biosynthesis O-methyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A0KU76 0.000274 45 39 4 78 3 rlmD 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD Shewanella sp. (strain ANA-3)
Q9URX7 0.000283 45 39 1 56 1 rmt1 Protein arginine N-methyltransferase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q0HXI0 0.000295 45 32 4 105 3 rlmD 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD Shewanella sp. (strain MR-7)
A1TSA0 0.000301 45 39 2 68 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paracidovorax citrulli (strain AAC00-1)
F0NBH8 0.00039 43 31 1 79 1 SiRe_1449 Protein-lysine N-methyltransferase Sulfolobus islandicus (strain REY15A)
Q13VB4 0.000393 44 37 3 77 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paraburkholderia xenovorans (strain LB400)
Q8MSW4 0.000395 44 44 0 45 1 Mettl5 rRNA N6-adenosine-methyltransferase Mettl5 Drosophila melanogaster
B2T641 0.000634 43 37 3 77 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q18511 0.000662 43 32 3 82 1 metl-5 rRNA N6-adenosine-methyltransferase metl-5 Caenorhabditis elegans
A2YP56 0.000674 44 38 0 49 3 PRMT3 Probable protein arginine N-methyltransferase 3 Oryza sativa subsp. indica

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_03905
Feature type CDS
Gene prmA
Product 50S ribosomal protein L11 methyltransferase
Location 98402 - 99286 (strand: 1)
Length 885 (nucleotides) / 294 (amino acids)

Contig

Accession ZDB_681
Length 269562 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_755
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06325 Ribosomal protein L11 methyltransferase (PrmA)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2264 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L11 methylase PrmA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02687 ribosomal protein L11 methyltransferase [EC:2.1.1.-] - -

Protein Sequence

MPWIQIRLNSTGADAEVIGDELTETGAVSVTFQDSHDTPIFEPLPGETRLWGDTDVIGLYDAETDMKAVVAQLQQHPLLGENFVRKIEQIEDKDWEREWMDNFHPMRFGQRLWICPSWREIPDPDAVNVMLDPGLAFGTGTHPTTSLCLEWLDGLDLNGKTVIDFGCGSGILAIAALKLGAKEAIGIDIDPQAIQASRDNAERNGVSDRLTLYLSDKKPQTLSADVVVANILAGPLRELAPVIGALPQAGGLLGLSGVLATQAEGVADAYRDVFEIDEIAEKEEWCRITATKRG

Flanking regions ( +/- flanking 50bp)

CCTGTCAAACAGGGGCTTTTTTATAAAGAGCTTTTTATAAAGAGTATGTTATGCCCTGGATCCAAATACGATTAAATTCCACCGGTGCTGATGCCGAAGTTATCGGTGATGAACTGACTGAAACCGGTGCGGTCTCCGTTACCTTTCAGGACAGCCACGACACCCCGATTTTTGAACCGCTGCCGGGGGAAACCCGCCTGTGGGGCGATACCGACGTGATCGGCCTGTATGACGCTGAAACGGACATGAAAGCCGTTGTTGCGCAATTACAGCAGCATCCGCTGCTCGGCGAAAACTTTGTCCGTAAAATCGAACAGATTGAAGACAAAGACTGGGAACGCGAGTGGATGGATAACTTCCACCCGATGCGTTTCGGTCAGCGCCTGTGGATCTGCCCGAGCTGGCGTGAGATCCCTGACCCTGATGCGGTCAATGTTATGCTCGATCCGGGCCTTGCATTCGGCACCGGTACCCACCCGACCACCTCTCTGTGCCTGGAATGGCTCGACGGGCTGGATCTGAACGGTAAAACCGTGATCGATTTCGGCTGCGGCTCCGGGATCCTGGCGATCGCCGCCCTGAAACTGGGTGCGAAAGAAGCTATCGGTATCGATATCGACCCGCAGGCGATTCAGGCCAGCAGGGACAACGCAGAGCGCAACGGCGTTTCAGACAGGCTGACCCTTTACCTCTCTGATAAAAAGCCTCAGACGCTCTCTGCGGACGTTGTGGTGGCCAATATCCTGGCCGGTCCGCTGCGTGAACTGGCGCCGGTGATCGGCGCACTGCCGCAGGCCGGCGGATTACTCGGGTTATCCGGTGTGCTCGCCACTCAGGCGGAAGGTGTGGCAGATGCTTACCGTGACGTCTTTGAGATTGATGAGATTGCCGAAAAAGAAGAATGGTGCCGGATCACCGCAACAAAACGCGGCTGATATTCTTACTTTTTGGTATATAAATCGTGCATTTGCGTGATTCAGTGAAT