Homologs in group_5

Help

24 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03290 FBDBKF_03290 100.0 Morganella morganii S1 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
FBDBKF_04575 FBDBKF_04575 30.8 Morganella morganii S1 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
FBDBKF_14810 FBDBKF_14810 40.8 Morganella morganii S1 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
FBDBKF_18095 FBDBKF_18095 27.5 Morganella morganii S1 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
EHELCC_05865 EHELCC_05865 30.8 Morganella morganii S2 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
EHELCC_07245 EHELCC_07245 100.0 Morganella morganii S2 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
EHELCC_15615 EHELCC_15615 40.8 Morganella morganii S2 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
EHELCC_16795 EHELCC_16795 27.5 Morganella morganii S2 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
NLDBIP_06185 NLDBIP_06185 30.8 Morganella morganii S4 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
NLDBIP_07570 NLDBIP_07570 100.0 Morganella morganii S4 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
NLDBIP_16145 NLDBIP_16145 40.8 Morganella morganii S4 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
NLDBIP_17655 NLDBIP_17655 27.5 Morganella morganii S4 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
LHKJJB_03065 LHKJJB_03065 30.8 Morganella morganii S3 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
LHKJJB_07105 LHKJJB_07105 100.0 Morganella morganii S3 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
LHKJJB_15695 LHKJJB_15695 40.8 Morganella morganii S3 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
LHKJJB_17575 LHKJJB_17575 27.5 Morganella morganii S3 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
HKOGLL_06540 HKOGLL_06540 30.8 Morganella morganii S5 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
HKOGLL_14815 HKOGLL_14815 40.8 Morganella morganii S5 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
HKOGLL_17390 HKOGLL_17390 27.5 Morganella morganii S5 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
F4V73_RS04180 F4V73_RS04180 37.7 Morganella psychrotolerans - ABC transporter substrate-binding protein
F4V73_RS07610 F4V73_RS07610 41.3 Morganella psychrotolerans - ABC transporter substrate-binding protein
F4V73_RS09030 F4V73_RS09030 31.5 Morganella psychrotolerans - ABC transporter substrate-binding protein
F4V73_RS10300 F4V73_RS10300 27.7 Morganella psychrotolerans - ABC transporter substrate-binding protein
PMI_RS01155 PMI_RS01155 31.9 Proteus mirabilis HI4320 - ABC transporter substrate-binding protein

Distribution of the homologs in the orthogroup group_5

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_5

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q57550 2.41e-08 58 22 14 344 3 MJ0085 Uncharacterized lipoprotein MJ0085 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P44206 2.84e-08 58 24 19 372 1 molA Molybdate-binding protein MolA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A4TPX1 3e-07 54 27 8 168 3 btuF Vitamin B12-binding protein Yersinia pestis (strain Pestoides F)
Q1CLU2 3e-07 54 27 8 168 3 btuF Vitamin B12-binding protein Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1E1 3e-07 54 27 8 168 3 btuF Vitamin B12-binding protein Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBM3 3e-07 54 27 8 168 3 btuF Vitamin B12-binding protein Yersinia pestis
Q1C3X6 3e-07 54 27 8 168 3 btuF Vitamin B12-binding protein Yersinia pestis bv. Antiqua (strain Antiqua)
Q66EE7 3.03e-07 54 27 8 168 3 btuF Vitamin B12-binding protein Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K552 3.03e-07 54 27 8 168 3 btuF Vitamin B12-binding protein Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FM05 3.03e-07 54 27 8 168 3 btuF Vitamin B12-binding protein Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JK18 1.18e-06 53 26 8 168 3 btuF Vitamin B12-binding protein Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7MXP0 0.000136 46 25 6 158 3 btuF Vitamin B12-binding protein Vibrio campbellii (strain ATCC BAA-1116)
Q6D1Z3 0.00017 46 23 6 177 3 btuF Vitamin B12-binding protein Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_03825
Feature type CDS
Gene fepB
Product ABC-type Fe3+-hydroxamate transport system, periplasmic component
Location 80011 - 81108 (strand: 1)
Length 1098 (nucleotides) / 365 (amino acids)
In genomic island -

Contig

Accession ZDB_681
Length 269562 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_5
Orthogroup size 25
N. genomes 7

Actions

Genomic region

Domains

PF01497 Periplasmic binding protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0614 Inorganic ion transport and metabolism (P) P ABC-type Fe3+-hydroxamate transport system, periplasmic component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02016 iron complex transport system substrate-binding protein - -

Protein Sequence

MKHLFSGLLLMAFSLLCGAKTVTDSLGRTVTVPDDPQRIVLGESRMLYTLALIETGNPAARVVGWPADLQRLDSQTWGKYAAAFPAIRDITIVGNDNFSQLNIEKIIALQPDLIIMPVYAKSRPDKTQFAHQTAAAGIPVIYLDFRVDPLRNTVPSLKTLGEVLNRQEKTATFTAFYQQHMDVIRNRLAMHNPHRPKVLLQLHLGKKAECCTTAASGNLADLLAFSGGDNIAAGKFSGVFGRLSPEQVLSDNPEYYLVTGSGGRDNRGQLQLGPDLRPDTARQSLQEQLQKDPVIAALPAVREGRTAALWHHVYLSPWHLLAAEFFARELHPDLFSDVDPQKTLDEMNRRFLSVPETGTYWLFSR

Flanking regions ( +/- flanking 50bp)

CGCCGGAGAGCCGCGCACCCTGTTCCTGAATGCCTCAGTGGACTTCTGATATGAAACATCTCTTTTCCGGGCTGCTGCTGATGGCATTTTCGCTGCTGTGCGGGGCAAAAACCGTTACGGACAGTCTCGGGCGGACAGTCACGGTTCCGGATGATCCGCAGCGGATAGTACTCGGTGAAAGCAGGATGCTCTATACCCTGGCACTGATCGAAACCGGTAATCCGGCGGCGCGTGTCGTCGGGTGGCCGGCTGATTTACAGCGACTCGATTCGCAGACATGGGGAAAATATGCGGCTGCATTTCCGGCGATCAGGGATATTACCATTGTCGGGAACGATAATTTTTCACAGCTTAATATTGAGAAAATCATCGCCCTGCAACCGGATCTGATTATTATGCCGGTGTATGCCAAATCCCGTCCTGATAAAACGCAATTTGCACACCAGACCGCAGCCGCCGGTATTCCGGTGATTTACCTGGATTTCAGGGTGGATCCGTTGCGGAACACGGTTCCGTCACTGAAAACGCTGGGCGAAGTTCTGAACCGGCAGGAAAAAACTGCCACTTTTACTGCGTTTTATCAGCAGCATATGGACGTGATCCGCAACCGTCTGGCTATGCACAATCCGCATCGCCCCAAAGTTTTGCTGCAGTTACATCTCGGGAAAAAAGCAGAATGCTGCACGACTGCAGCTTCCGGAAATCTGGCCGATTTACTGGCCTTTTCCGGCGGGGATAACATTGCAGCAGGGAAGTTCAGTGGTGTTTTCGGACGGCTCAGCCCGGAGCAGGTATTGTCGGATAATCCGGAATATTATCTGGTGACCGGCAGCGGCGGAAGGGATAACCGGGGGCAGTTACAACTGGGGCCGGATCTCCGCCCTGACACCGCCCGGCAAAGCCTGCAGGAACAATTACAGAAAGATCCGGTGATTGCCGCACTGCCTGCTGTCCGGGAAGGACGGACCGCCGCACTCTGGCATCATGTTTATCTCAGCCCGTGGCATCTGCTGGCAGCGGAGTTTTTCGCGCGGGAACTGCACCCGGATCTCTTTTCTGATGTTGATCCGCAGAAGACACTGGATGAAATGAACCGGCGGTTCCTGTCTGTACCGGAAACCGGGACTTACTGGCTGTTTTCGCGATAATCGCTGCTGTTTTCTGCATTTTCACTCCCGGAGGCGGATACTCCGGCTCC