Homologs in group_700

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03015 FBDBKF_03015 100.0 Morganella morganii S1 elaB DUF883 domain-containing protein
EHELCC_07520 EHELCC_07520 100.0 Morganella morganii S2 elaB DUF883 domain-containing protein
NLDBIP_07845 NLDBIP_07845 100.0 Morganella morganii S4 elaB DUF883 domain-containing protein
LHKJJB_07380 LHKJJB_07380 100.0 Morganella morganii S3 elaB DUF883 domain-containing protein
F4V73_RS11900 F4V73_RS11900 87.0 Morganella psychrotolerans - YqjD family protein
PMI_RS18405 PMI_RS18405 69.0 Proteus mirabilis HI4320 - YqjD family protein

Distribution of the homologs in the orthogroup group_700

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_700

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64584 5.6e-38 125 62 0 97 3 yqjD Uncharacterized protein YqjD Shigella flexneri
P64581 5.6e-38 125 62 0 97 1 yqjD Uncharacterized protein YqjD Escherichia coli (strain K12)
P64582 5.6e-38 125 62 0 97 3 yqjD Uncharacterized protein YqjD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P64583 5.6e-38 125 62 0 97 3 yqjD Uncharacterized protein YqjD Escherichia coli O157:H7
P0ADQ7 8.9e-20 80 41 1 94 1 ygaM Uncharacterized protein YgaM Escherichia coli (strain K12)
P0ADQ8 8.9e-20 80 41 1 94 3 ygaM Uncharacterized protein YgaM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ADQ9 8.9e-20 80 41 1 94 3 ygaM Uncharacterized protein YgaM Escherichia coli O157:H7
P0AEH5 1e-07 48 31 0 73 1 elaB Protein ElaB Escherichia coli (strain K12)
P0AEH6 1e-07 48 31 0 73 3 elaB Protein ElaB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEH7 1e-07 48 31 0 73 3 elaB Protein ElaB Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_03550
Feature type CDS
Gene elaB
Product DUF883 domain-containing protein
Location 29285 - 29587 (strand: 1)
Length 303 (nucleotides) / 100 (amino acids)

Contig

Accession ZDB_681
Length 269562 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_700
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF05957 DUF883 N-terminal domain
PF19029 DUF883 C-terminal glycine zipper region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4575 Translation, ribosomal structure and biogenesis (J) J Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05594 ElaB protein - -

Protein Sequence

MSHHTNEELRAELKSLADTLESVLNTAESKSKEEVDSLKKKAQAALENSRTRLAEGKEQVVQQTKEIAGKADNYVRENPWTGVGIGAAVGVVLGVLLARR

Flanking regions ( +/- flanking 50bp)

AAAGCGGTTACTTTGAATCTGTTACGCTATAACCACCACGAGGAGTTCCTATGTCACATCATACAAATGAAGAGTTACGCGCTGAACTGAAATCATTGGCTGACACCCTGGAATCTGTGCTGAATACGGCAGAAAGTAAATCCAAAGAAGAAGTGGATTCACTGAAGAAAAAAGCACAGGCCGCGCTGGAAAATTCCCGTACCCGCCTCGCGGAAGGGAAAGAGCAGGTTGTGCAGCAGACAAAAGAGATCGCAGGCAAAGCCGATAATTATGTCCGCGAAAATCCGTGGACCGGCGTCGGTATCGGTGCCGCTGTCGGTGTGGTGTTAGGTGTTTTACTGGCCCGCCGCTGAGTTATGACCGATCAGGAGCGTCCGCAGGGGCCCGGCAAAGGGCTCCTTGA