Homologs in group_460

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00640 FBDBKF_00640 100.0 Morganella morganii S1 fliP flagellar type III secretion system pore protein FliP
EHELCC_00905 EHELCC_00905 100.0 Morganella morganii S2 fliP flagellar type III secretion system pore protein FliP
NLDBIP_02555 NLDBIP_02555 100.0 Morganella morganii S4 fliP flagellar type III secretion system pore protein FliP
LHKJJB_04070 LHKJJB_04070 100.0 Morganella morganii S3 fliP flagellar type III secretion system pore protein FliP
F4V73_RS06650 F4V73_RS06650 91.0 Morganella psychrotolerans fliP flagellar type III secretion system pore protein FliP
PMI_RS08010 PMI_RS08010 74.8 Proteus mirabilis HI4320 fliP flagellar type III secretion system pore protein FliP

Distribution of the homologs in the orthogroup group_460

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_460

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AC05 3.7e-126 360 76 0 233 3 fliP Flagellar biosynthetic protein FliP Escherichia coli (strain K12)
P0AC06 3.7e-126 360 76 0 233 3 fliP Flagellar biosynthetic protein FliP Escherichia coli O157:H7
P54700 1.03e-124 357 76 0 234 1 fliP Flagellar biosynthetic protein FliP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P57184 9.41e-120 349 67 0 243 3 fliP Flagellar biosynthetic protein FliP Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8KA37 2.21e-116 340 72 0 223 3 fliP Flagellar biosynthetic protein FliP Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P34200 6.4e-115 332 74 0 236 3 fliP Flagellar biosynthetic protein FliP Pectobacterium carotovorum subsp. carotovorum
Q89AZ2 7.5e-113 331 64 1 240 3 fliP Flagellar biosynthetic protein FliP Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q51468 2.09e-83 252 59 0 211 3 fliP Flagellar biosynthetic protein FliP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P35528 2.17e-75 231 54 0 208 3 fliP Flagellar biosynthetic protein FliP Bacillus subtilis (strain 168)
O85133 2.5e-75 233 55 0 211 3 fliP Flagellar biosynthetic protein FliP Cereibacter sphaeroides
Q45980 2.66e-73 227 53 0 202 3 fliP Flagellar biosynthetic protein FliP Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
O67750 3.71e-71 220 50 1 204 3 fliP Flagellar biosynthetic protein FliP Aquifex aeolicus (strain VF5)
Q44344 1.18e-63 201 47 2 204 3 fliP Flagellar biosynthetic protein FliP Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9X5A6 1.56e-62 199 47 1 214 3 fliP Flagellar biosynthetic protein FliP Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
P37827 1.22e-61 196 44 1 214 3 fliP Flagellar biosynthetic protein FliP Rhizobium meliloti (strain 1021)
Q44763 3e-59 191 48 1 192 3 fliP Flagellar biosynthetic protein FliP Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
P74930 3.6e-55 181 45 1 214 3 fliP Flagellar biosynthetic protein FliP Treponema pallidum (strain Nichols)
P37828 1.42e-46 157 41 2 205 3 None Pathogenicity-related ORF2 Xanthomonas campestris pv. glycines
Q46646 2.71e-43 149 41 6 216 3 hrcR Harpin secretion protein HrcR Erwinia amylovora
Q52488 1.07e-42 147 39 2 201 3 hrcR Hypersensitivity response secretion protein HrcR Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P74890 2.7e-41 143 39 4 219 2 yscR Virulence protein YscR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P69981 5.44e-41 142 41 2 191 3 yscR Yop proteins translocation protein R Yersinia pseudotuberculosis serotype I (strain IP32953)
P69980 5.44e-41 142 41 2 191 3 yscR Yop proteins translocation protein R Yersinia pestis
P55720 1.52e-36 131 41 4 194 3 NGR_a00610 Probable translocation protein y4yL Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0A1L4 6.46e-36 129 38 6 211 3 spaP Surface presentation of antigens protein SpaP Shigella sonnei
P0A1L3 6.46e-36 129 38 6 211 1 spaP Surface presentation of antigens protein SpaP Shigella flexneri
Q47856 1.05e-34 126 38 3 209 3 hrcR Harpin secretion protein HrcR Pantoea agglomerans pv. gypsophilae
Q60236 2.41e-33 122 42 4 209 3 hrpW Harpin secretion protein HrpW Pseudomonas syringae pv. syringae
P40700 1.19e-28 111 40 7 209 1 spaP Surface presentation of antigens protein SpaP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q56023 1.25e-27 108 39 6 208 3 spaP Surface presentation of antigens protein SpaP Salmonella typhi

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_02975
Feature type CDS
Gene fliP
Product flagellar type III secretion system pore protein FliP
Location 202030 - 202770 (strand: -1)
Length 741 (nucleotides) / 246 (amino acids)

Contig

Accession ZDB_680
Length 282413 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_460
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00813 FliP family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1338 Cell motility (N) N Flagellar biosynthesis protein FliP

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02419 flagellar biosynthesis protein FliP Flagellar assembly -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG002338 flagellar biosynthetic protein FliP VF0394 Motility

Protein Sequence

MMSLLKRAIPALALFLLVPQAQASLPGVVSHVLPDGGQSWSLPVQTLLFLTLLGFIPALLLMTTSFTRIIIVLGLLRNALGTPSAPPNQVLLGLALFLTFFVMSPVFDKVYEDAYRPFSEDKISLETALDRGTAPLRTFMLGQTRENDLALFARIAKVGEIQEAKDVPMRILIPAFITSELKTAFQIGFTLFIPFLIIDLVVASVLMALGMMMVPPATVSLPFKLMLFVLVDGWQLLLGSLSQSFF

Flanking regions ( +/- flanking 50bp)

ACCGCAAATAAAGATGCGGTACCGGCTGACGAACCACGCTGAGATTTTTCATGATGTCATTGCTCAAACGCGCCATTCCCGCACTCGCTCTGTTTCTGCTGGTTCCGCAGGCGCAGGCTTCACTGCCGGGCGTCGTCAGTCATGTGCTGCCGGACGGCGGCCAGAGCTGGTCTCTGCCGGTTCAGACCCTGCTGTTTCTGACACTGCTGGGCTTTATCCCTGCTCTGCTGCTGATGACCACCAGTTTTACCCGCATCATTATTGTGCTGGGTTTATTACGCAACGCACTCGGGACACCGTCCGCACCGCCGAACCAGGTTCTGCTGGGACTGGCCCTGTTTCTGACGTTTTTCGTGATGTCACCGGTGTTCGATAAAGTCTACGAAGATGCTTACCGTCCGTTCAGTGAAGACAAAATCAGCCTGGAAACGGCACTGGATCGCGGTACTGCACCACTGCGCACATTTATGCTCGGCCAGACACGCGAAAACGACCTAGCACTGTTTGCCCGTATCGCCAAAGTGGGTGAAATTCAGGAAGCCAAAGATGTGCCGATGCGCATTCTGATCCCGGCCTTTATCACCAGTGAGCTGAAAACCGCCTTCCAGATTGGTTTCACGCTGTTTATTCCGTTCCTGATTATTGACCTCGTGGTTGCCAGTGTACTGATGGCACTCGGGATGATGATGGTACCGCCCGCCACGGTTTCGCTGCCCTTTAAGCTGATGCTTTTTGTGCTGGTGGATGGCTGGCAGTTACTGCTCGGTTCGTTATCACAAAGCTTTTTTTAGTCAGGAGATAATATGAGTCAGGAGAGAGTATGACACCGGAATCCGTAATG