Homologs in group_228

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00945 FBDBKF_00945 100.0 Morganella morganii S1 mdaB Putative NADPH-quinone reductase (modulator of drug activity B)
EHELCC_00600 EHELCC_00600 100.0 Morganella morganii S2 mdaB Putative NADPH-quinone reductase (modulator of drug activity B)
NLDBIP_02860 NLDBIP_02860 100.0 Morganella morganii S4 mdaB Putative NADPH-quinone reductase (modulator of drug activity B)
LHKJJB_04375 LHKJJB_04375 100.0 Morganella morganii S3 mdaB Putative NADPH-quinone reductase (modulator of drug activity B)
F4V73_RS06940 F4V73_RS06940 84.0 Morganella psychrotolerans - NAD(P)H-dependent oxidoreductase
F4V73_RS10240 F4V73_RS10240 51.6 Morganella psychrotolerans - NAD(P)H-dependent oxidoreductase
PMI_RS09530 PMI_RS09530 53.1 Proteus mirabilis HI4320 - NAD(P)H-dependent oxidoreductase

Distribution of the homologs in the orthogroup group_228

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_228

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEY5 2.33e-75 227 55 0 188 1 mdaB NADPH:quinone oxidoreductase MdaB Escherichia coli (strain K12)
P0AEY6 2.33e-75 227 55 0 188 3 mdaB NADPH:quinone oxidoreductase MdaB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEY7 2.33e-75 227 55 0 188 1 mdaB NADPH:quinone oxidoreductase MdaB Escherichia coli O157:H7
P44803 2.4e-67 207 50 0 187 3 mdaB NADPH:quinone oxidoreductase MdaB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q09677 2.43e-65 202 48 0 186 3 SPAC5H10.05c Uncharacterized protein C5H10.05c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A0A481WNM5 4.44e-09 57 34 6 130 3 traD Ribosyldihydronicotinamide dehydrogenase-like protein traD Penicillium crustosum
P96674 1.87e-06 49 24 4 147 3 ydeQ Uncharacterized NAD(P)H oxidoreductase YdeQ Bacillus subtilis (strain 168)
B7LVT7 3.77e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LFY0 5.06e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain SMS-3-5 / SECEC)
B6HYZ7 5.06e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain SE11)
B7N7S1 5.06e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A754 5.06e-05 45 29 7 155 1 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain K12)
P0A755 5.06e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7ZVZ8 5.06e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O9:H4 (strain HS)
B1XC47 5.06e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain K12 / DH10B)
C4ZPX2 5.06e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0E3 5.06e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O8 (strain IAI1)
B7MNQ3 5.06e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O81 (strain ED1a)
B7NHF0 5.06e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7L4G9 5.06e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain 55989 / EAEC)
B7UI92 5.06e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHD9 5.06e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O139:H28 (strain E24377A / ETEC)
B5YZ82 5.36e-05 45 30 4 118 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XA24 5.36e-05 45 30 4 118 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O157:H7
Q1RGF2 5.63e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain UTI89 / UPEC)
A1A795 5.63e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O1:K1 / APEC
B7MAG9 5.63e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0TLU3 5.74e-05 45 29 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P54439 0.000423 42 24 4 122 3 yrkL Uncharacterized NAD(P)H oxidoreductase YrkL Bacillus subtilis (strain 168)
Q3Z5W3 0.00044 42 28 7 155 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Shigella sonnei (strain Ss046)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_02670
Feature type CDS
Gene mdaB
Product Putative NADPH-quinone reductase (modulator of drug activity B)
Location 135502 - 136086 (strand: 1)
Length 585 (nucleotides) / 194 (amino acids)

Contig

Accession ZDB_680
Length 282413 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_228
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF02525 Flavodoxin-like fold

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2249 General function prediction only (R) R Putative NADPH-quinone reductase (modulator of drug activity B)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03923 NADPH dehydrogenase (quinone) [EC:1.6.5.10] - -

Protein Sequence

MKNIFIINGSKEFGGSDGKLNDHMTDIARRHLTEKGMNVRVTRIDDGYDDEQEVLNYLWADVIIYQMPAWWMEGPWIVKKYIDEVFTQSDDRFHINDGRSRRDSSKKYGSGGVLTGKKYMLSVTWNAPQEAFEDEKQFFEGRGIDSVYFPLHKTNQFTGMTSLPTFSCFDVVKNPHIDADICRYLAHLDVNIAG

Flanking regions ( +/- flanking 50bp)

GCCGGTTAGGATAACAGGATTGACGACATCATTCCTGAGTGAGTAACACAATGAAAAACATCTTTATTATTAACGGTTCAAAAGAATTCGGCGGCTCTGACGGCAAACTGAACGACCATATGACCGATATCGCCCGCCGCCATCTGACAGAAAAAGGCATGAATGTCCGCGTTACCCGTATTGATGACGGTTATGACGATGAACAGGAAGTACTGAATTACCTGTGGGCGGATGTGATTATTTACCAGATGCCGGCCTGGTGGATGGAAGGGCCGTGGATTGTGAAAAAATACATTGATGAGGTATTTACACAGTCTGATGACCGTTTTCATATTAATGACGGGCGCAGCCGCCGTGACAGCAGTAAAAAATACGGCTCCGGCGGTGTGCTGACCGGTAAAAAATACATGTTATCCGTGACCTGGAACGCACCGCAGGAAGCCTTTGAGGATGAAAAGCAGTTCTTTGAGGGGCGGGGTATCGACAGTGTGTATTTCCCGCTCCACAAAACCAATCAGTTTACCGGGATGACATCACTGCCGACATTTTCCTGTTTTGATGTGGTTAAAAACCCGCATATTGATGCGGATATTTGCCGCTATCTGGCTCACCTGGATGTGAATATCGCAGGCTGAACCCTCAGCGGGCCACTGATGCCAGGCGCAGACCAAGAGCGATAAAGGTG