Homologs in group_2557

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02305 FBDBKF_02305 100.0 Morganella morganii S1 crp cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases
EHELCC_02775 EHELCC_02775 100.0 Morganella morganii S2 crp cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases
NLDBIP_00685 NLDBIP_00685 100.0 Morganella morganii S4 crp cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases
LHKJJB_01350 LHKJJB_01350 100.0 Morganella morganii S3 crp cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases
F4V73_RS04680 F4V73_RS04680 87.4 Morganella psychrotolerans - Crp/Fnr family transcriptional regulator

Distribution of the homologs in the orthogroup group_2557

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2557

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P47200 2.01e-14 73 26 2 196 4 fnrA Transcriptional activator protein FnrA Stutzerimonas stutzeri
P23926 2.73e-13 70 25 3 216 4 anr Transcriptional activator protein anr Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O85222 1.73e-12 68 25 2 196 2 anr Transcriptional activator protein Anr Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q9AQ50 1.81e-12 68 26 3 195 3 fnr Fumarate nitrate reduction regulatory protein Klebsiella oxytoca
P0A9E8 3.15e-12 67 26 3 191 3 fnr Fumarate and nitrate reduction regulatory protein Shigella flexneri
P0A9E5 3.15e-12 67 26 3 191 1 fnr Fumarate and nitrate reduction regulatory protein Escherichia coli (strain K12)
P0A9E6 3.15e-12 67 26 3 191 3 fnr Fumarate and nitrate reduction regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9E7 3.15e-12 67 26 3 191 3 fnr Fumarate and nitrate reduction regulatory protein Escherichia coli O157:H7
Q9LA24 5.07e-12 67 25 2 191 3 fnr Fumarate and nitrate reduction regulatory protein Shigella dysenteriae
Q8Z787 8.65e-12 66 26 3 191 3 fnr Fumarate and nitrate reduction regulatory protein Salmonella typhi
P0A2T8 1.11e-11 65 26 3 191 3 fnr Fumarate and nitrate reduction regulatory protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2T9 1.11e-11 65 26 3 191 3 fnr Fumarate and nitrate reduction regulatory protein Salmonella muenster
Q8ZE82 8.75e-11 63 25 3 192 3 fnr Fumarate and nitrate reduction regulatory protein Yersinia pestis
Q5SID7 7.84e-10 60 25 2 216 1 TTHA1437 Cyclic AMP receptor protein Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P0C6D0 1.84e-09 59 24 2 191 3 fnr Fumarate and nitrate reduction regulatory protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F890 1.84e-09 59 24 2 191 3 fnr Fumarate and nitrate reduction regulatory protein Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P46148 3.35e-09 58 24 3 196 3 etrA Electron transport regulator A Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P29284 2.1e-08 56 26 4 215 4 flp Probable transcriptional regulator flp Lacticaseibacillus casei
Q08530 3.35e-07 53 27 2 161 4 btr Transcriptional regulatory protein btr Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P45199 3.67e-07 53 24 3 191 3 fnr Anaerobic regulatory protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P23619 4.43e-07 52 24 3 182 4 hlyX Regulatory protein HlyX Actinobacillus pleuropneumoniae
Q9EXQ1 5.51e-07 52 23 3 191 2 fnr Anaerobic regulatory protein Aggregatibacter actinomycetemcomitans
Q9CMY2 5.64e-07 52 23 3 191 3 fnr Anaerobic regulatory protein Pasteurella multocida (strain Pm70)
Q01980 7.36e-07 52 22 3 197 1 aadR Transcriptional activatory protein AadR Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P29286 2.01e-05 47 23 5 206 2 fixK Nitrogen fixation regulation protein FixK Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P9WMH3 5.93e-05 46 22 3 221 1 crp CRP-like cAMP-activated global transcriptional regulator Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMH2 5.93e-05 46 22 3 221 1 crp CRP-like cAMP-activated global transcriptional regulator Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P13295 0.000585 43 22 5 180 4 fixK Nitrogen fixation regulation protein FixK Rhizobium meliloti (strain 1021)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_01390
Feature type CDS
Gene crp
Product cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases
Location 253928 - 254644 (strand: 1)
Length 717 (nucleotides) / 238 (amino acids)
In genomic island -

Contig

Accession ZDB_679
Length 398279 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2557
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00027 Cyclic nucleotide-binding domain
PF13545 Crp-like helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0664 Signal transduction mechanisms (T) T cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K21563 CRP/FNR family transcriptional regulator, dissimilatory nitrate respiration regulator - -

Protein Sequence

MTFVKKTLAPAQQMAILRSCPLFQAAEDDDLTLVLADSTHRQFAAGELISREGETVKACPLMISGQIDVFRHTWSGEEKVFGMFTAGELVAIAAVFMPHNRFPMSLRARTDSSALMLDKQAILQLCHACPAIMAQLLARFSLKLYENINHIDWLTSSSAEQRLAAYLLDLKRCQQSDCVVLPLSRGQLAAKLGVRYETLSRLFSGWRQKAFIGIDKDAVRITNESYLAELAIPAQRPF

Flanking regions ( +/- flanking 50bp)

GTTATCATTTATAATTGCATTTATTCTGGCCGTACTGAGAGGAAAATCCTATGACATTTGTCAAAAAGACCCTTGCCCCCGCACAGCAAATGGCGATCCTCCGGTCGTGCCCGTTATTTCAGGCGGCAGAGGATGATGATCTGACGCTGGTACTGGCAGACAGCACACATCGTCAGTTTGCGGCGGGGGAATTGATCAGTCGTGAAGGAGAGACCGTAAAAGCCTGTCCGCTGATGATCAGCGGGCAGATTGATGTTTTCCGTCACACCTGGTCGGGTGAGGAAAAAGTATTCGGTATGTTTACCGCCGGTGAGCTGGTGGCGATTGCTGCTGTCTTTATGCCGCACAATCGCTTCCCGATGAGCCTGCGGGCGAGAACAGACAGCAGTGCGCTGATGCTGGATAAACAGGCGATTTTACAGCTGTGTCATGCCTGTCCGGCAATTATGGCGCAGTTACTGGCGCGGTTCAGCCTGAAGCTGTATGAGAATATTAACCATATCGACTGGCTGACCTCCAGCTCCGCAGAGCAGCGGCTGGCAGCTTATCTGCTGGATCTGAAACGGTGCCAGCAATCGGATTGTGTGGTGCTGCCGTTATCGCGCGGGCAGTTAGCCGCAAAACTGGGTGTTCGTTATGAAACTCTCAGCCGCCTGTTTTCCGGCTGGCGGCAGAAAGCGTTTATCGGAATTGATAAAGACGCGGTGCGGATCACCAATGAATCCTATCTGGCGGAACTGGCTATCCCGGCGCAGCGCCCGTTCTGAATAAATAAAAAAATCCCCGCCGGGCGGGGATTTCTTATATCAGTAAGATC