Homologs in group_2523

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02270 FBDBKF_02270 100.0 Morganella morganii S1 - ATP-grasp domain-containing protein
EHELCC_02740 EHELCC_02740 100.0 Morganella morganii S2 - ATP-grasp domain-containing protein
NLDBIP_00720 NLDBIP_00720 100.0 Morganella morganii S4 - ATP-grasp domain-containing protein
LHKJJB_01315 LHKJJB_01315 100.0 Morganella morganii S3 - ATP-grasp domain-containing protein
F4V73_RS04650 F4V73_RS04650 69.1 Morganella psychrotolerans - ATP-grasp domain-containing protein

Distribution of the homologs in the orthogroup group_2523

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2523

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_01355
Feature type CDS
Gene -
Product ATP-grasp domain-containing protein
Location 249312 - 249524 (strand: -1)
Length 213 (nucleotides) / 70 (amino acids)

Contig

Accession ZDB_679
Length 398279 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2523
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF14243 ATP-grasp domain, R2K clade family 3

Protein Sequence

MLNGQAFSADDNIPPVVREIADIITTPFFSVDITENTAGELRLIEIGDGQVSDIKEWDTEKFITLFSGAD

Flanking regions ( +/- flanking 50bp)

GCCTCAGGCACTATGAATATTATAAAACTGACAGCGAACGCCGCTATTTTGTGCTGAATGGTCAGGCTTTCTCTGCTGATGATAATATCCCGCCTGTTGTCCGGGAAATTGCAGATATCATTACCACACCTTTCTTCTCTGTGGATATTACGGAAAATACAGCCGGTGAATTACGTCTGATAGAAATCGGCGACGGTCAGGTCTCCGATATAAAAGAATGGGATACTGAAAAATTTATTACTCTGTTTTCTGGTGCTGACTGAGATTACATTTCGTTATGGCTCACTCACAACACATAACCTATCCATCAAAA