Homologs in group_731

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02265 FBDBKF_02265 100.0 Morganella morganii S1 ycgN YcgN family cysteine cluster protein
EHELCC_02735 EHELCC_02735 100.0 Morganella morganii S2 ycgN YcgN family cysteine cluster protein
NLDBIP_00725 NLDBIP_00725 100.0 Morganella morganii S4 ycgN YcgN family cysteine cluster protein
LHKJJB_01310 LHKJJB_01310 100.0 Morganella morganii S3 ycgN YcgN family cysteine cluster protein
F4V73_RS04635 F4V73_RS04635 92.6 Morganella psychrotolerans - YcgN family cysteine cluster protein
PMI_RS05665 PMI_RS05665 77.4 Proteus mirabilis HI4320 - YcgN family cysteine cluster protein

Distribution of the homologs in the orthogroup group_731

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_731

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N519 3.58e-85 248 81 1 144 3 plu2141 UPF0260 protein plu2141 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4EVW1 1.73e-82 242 76 1 146 3 PMI1174 UPF0260 protein PMI1174 Proteus mirabilis (strain HI4320)
Q8ZP12 3.86e-79 233 76 1 141 3 ycgN UPF0260 protein YcgN Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TXY1 3.86e-79 233 76 1 141 3 ycgN UPF0260 protein YcgN Salmonella schwarzengrund (strain CVM19633)
C0Q324 3.86e-79 233 76 1 141 3 ycgN UPF0260 protein YcgN Salmonella paratyphi C (strain RKS4594)
B4SUK4 3.86e-79 233 76 1 141 3 ycgN UPF0260 protein YcgN Salmonella newport (strain SL254)
B4TKE2 3.86e-79 233 76 1 141 3 ycgN UPF0260 protein YcgN Salmonella heidelberg (strain SL476)
B5R8Z0 3.86e-79 233 76 1 141 3 ycgN UPF0260 protein YcgN Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2V9 3.86e-79 233 76 1 141 3 ycgN UPF0260 protein YcgN Salmonella enteritidis PT4 (strain P125109)
B5FTM2 3.86e-79 233 76 1 141 3 ycgN UPF0260 protein YcgN Salmonella dublin (strain CT_02021853)
B5F3T1 5.3e-79 233 76 1 141 3 ycgN UPF0260 protein YcgN Salmonella agona (strain SL483)
B5BHE5 5.71e-79 233 76 1 141 3 ycgN UPF0260 protein YcgN Salmonella paratyphi A (strain AKU_12601)
Q5PCT8 5.71e-79 233 76 1 141 3 ycgN UPF0260 protein YcgN Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A9MVV6 8.31e-79 233 76 1 141 3 ycgN UPF0260 protein YcgN Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q8Z682 1.85e-78 232 76 1 141 3 ycgN UPF0260 protein YcgN Salmonella typhi
A9MP52 2e-78 232 76 1 141 3 ycgN UPF0260 protein YcgN Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8FI28 6.18e-78 230 76 1 142 3 ycgN UPF0260 protein YcgN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIJ4 6.18e-78 230 76 1 142 3 ycgN UPF0260 protein YcgN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P0A8L6 6.75e-78 230 76 1 142 3 ycgN UPF0260 protein YcgN Shigella flexneri
Q0T5L9 6.75e-78 230 76 1 142 3 ycgN UPF0260 protein YcgN Shigella flexneri serotype 5b (strain 8401)
B1LHY6 6.75e-78 230 76 1 142 3 ycgN UPF0260 protein YcgN Escherichia coli (strain SMS-3-5 / SECEC)
P0A8L5 6.75e-78 230 76 1 142 3 ycgN UPF0260 protein YcgN Escherichia coli (strain K12)
A7ZZB5 6.75e-78 230 76 1 142 3 ycgN UPF0260 protein YcgN Escherichia coli O9:H4 (strain HS)
B1XA68 6.75e-78 230 76 1 142 3 ycgN UPF0260 protein YcgN Escherichia coli (strain K12 / DH10B)
C4ZTM2 6.75e-78 230 76 1 142 3 ycgN UPF0260 protein YcgN Escherichia coli (strain K12 / MC4100 / BW2952)
Q8XDL7 6.75e-78 230 76 1 142 3 ycgN UPF0260 protein YcgN Escherichia coli O157:H7
A7ZKV2 6.75e-78 230 76 1 142 3 ycgN UPF0260 protein YcgN Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LSK2 7.04e-78 230 75 1 142 3 ycgN UPF0260 protein YcgN Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B2TZA8 1.33e-77 229 76 1 142 3 ycgN UPF0260 protein YcgN Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A6TAX0 3.3e-77 228 74 1 143 3 KPN78578_22800 UPF0260 protein KPN78578_22800 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A8AFR2 3.49e-77 228 75 1 141 3 CKO_01185 UPF0260 protein CKO_01185 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5XQ74 5.18e-77 228 73 1 145 3 KPK_1978 UPF0260 protein KPK_1978 Klebsiella pneumoniae (strain 342)
A7MNK3 7.77e-77 228 76 1 142 3 ESA_01462 UPF0260 protein ESA_01462 Cronobacter sakazakii (strain ATCC BAA-894)
A8GFG2 4.49e-76 226 75 2 145 3 Spro_2751 UPF0260 protein Spro_2751 Serratia proteamaculans (strain 568)
A4WBF7 3.06e-75 223 73 1 142 3 Ent638_2368 UPF0260 protein Ent638_2368 Enterobacter sp. (strain 638)
C6DG41 5e-74 220 72 1 143 3 PC1_1943 UPF0260 protein PC1_1943 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D4M5 1.53e-73 219 73 1 142 3 ECA2365 UPF0260 protein ECA2365 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JRA2 1.35e-71 214 71 2 146 3 YE2365 UPF0260 protein YE2365 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A9QYU7 8.17e-71 212 72 2 145 3 YpAngola_A2394 UPF0260 protein YpAngola_A2394 Yersinia pestis bv. Antiqua (strain Angola)
B2K3P3 8.17e-71 212 72 2 145 3 YPTS_2126 UPF0260 protein YPTS_2126 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B1JLI4 8.17e-71 212 72 2 145 3 YPK_2117 UPF0260 protein YPK_2117 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q8ZES0 8.17e-71 212 72 2 145 3 YPO2083 UPF0260 protein YPO2083/y2228/YP_1926 Yersinia pestis
Q66AR5 8.17e-71 212 72 2 145 3 YPTB2065 UPF0260 protein YPTB2065 Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FIA1 8.17e-71 212 72 2 145 3 YpsIP31758_2006 UPF0260 protein YpsIP31758_2006 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1CJE1 8.17e-71 212 72 2 145 3 YPN_1559 UPF0260 protein YPN_1559 Yersinia pestis bv. Antiqua (strain Nepal516)
Q1C7Z0 8.17e-71 212 72 2 145 3 YPA_1465 UPF0260 protein YPA_1465 Yersinia pestis bv. Antiqua (strain Antiqua)
A4TJH7 8.17e-71 212 72 2 145 3 YPDSF_1039 UPF0260 protein YPDSF_1039 Yersinia pestis (strain Pestoides F)
Q87MR2 4.67e-60 185 61 1 144 3 VP2169 UPF0260 protein VP2169 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B5FFK1 1.37e-59 184 58 1 144 3 VFMJ11_1786 UPF0260 protein VFMJ11_1786 Aliivibrio fischeri (strain MJ11)
Q5E491 1.37e-59 184 58 1 144 3 VF_1660 UPF0260 protein VF_1660 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A7MUF3 1.63e-58 181 59 1 145 3 VIBHAR_03078 UPF0260 protein VIBHAR_03078 Vibrio campbellii (strain ATCC BAA-1116)
B7VLA3 6.28e-57 177 57 1 144 3 VS_0923 UPF0260 protein VS_0923 Vibrio atlanticus (strain LGP32)
Q7MIW1 3.86e-56 175 53 1 145 3 VV2402 UPF0260 protein VV2402 Vibrio vulnificus (strain YJ016)
Q8DB14 3.89e-55 172 53 1 145 3 VV1_2014 UPF0260 protein VV1_2014 Vibrio vulnificus (strain CMCP6)
A5F2L8 6.3e-53 167 56 1 141 3 VC0395_A0576 UPF0260 protein VC0395_A0576/VC395_1072 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KT47 6.3e-53 167 56 1 141 3 VC_1058 UPF0260 protein VC_1058 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LTV5 6.3e-53 167 56 1 141 3 VCM66_1013 UPF0260 protein VCM66_1013 Vibrio cholerae serotype O1 (strain M66-2)
Q3JBE4 1.17e-50 161 53 2 143 3 Noc_1358 UPF0260 protein Noc_1358 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q60BF6 6.24e-50 159 53 1 139 3 MCA0521 UPF0260 protein MCA0521 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A9HGR3 1.74e-49 159 53 1 143 3 GDI1595 UPF0260 protein GDI1595/Gdia_1801 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q12NR0 1.51e-48 156 49 1 140 3 Sden_1632 UPF0260 protein Sden_1632 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B3PU35 1.66e-48 156 51 2 143 3 RHECIAT_CH0001358 UPF0260 protein RHECIAT_CH0001358 Rhizobium etli (strain CIAT 652)
A1S6X6 3.65e-48 155 49 1 140 3 Sama_1927 UPF0260 protein Sama_1927 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q1MJG9 6.8e-48 154 51 2 143 3 RL1394 UPF0260 protein RL1394 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8EE17 1.76e-47 153 49 1 141 3 SO_2573 UPF0260 protein SO_2573 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B5ZVD0 2.18e-47 153 51 2 143 3 Rleg2_0895 UPF0260 protein Rleg2_0895 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q2KAR9 2.47e-47 153 51 2 143 3 RHE_CH01262 UPF0260 protein RHE_CH01262 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B6JFZ6 4.95e-47 153 52 3 143 3 OCAR_6616 UPF0260 protein OCAR_6616/OCA5_c14500 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q0BQF8 5.75e-47 152 52 1 139 3 GbCGDNIH1_2046 UPF0260 protein GbCGDNIH1_2046 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q8YIB0 8.67e-47 152 59 1 122 3 BMEI0534 UPF0260 protein BMEI0534 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0REB5 8.67e-47 152 59 1 122 3 BMEA_A1529 UPF0260 protein BMEA_A1529 Brucella melitensis biotype 2 (strain ATCC 23457)
Q2YM28 8.67e-47 152 59 1 122 3 BAB1_1496 UPF0260 protein BAB1_1496 Brucella abortus (strain 2308)
Q57C34 8.67e-47 152 59 1 122 3 BruAb1_1472 UPF0260 protein BruAb1_1472 Brucella abortus biovar 1 (strain 9-941)
B0CHR3 1.4e-46 151 58 1 122 3 BSUIS_A1532 UPF0260 protein BSUIS_A1532 Brucella suis (strain ATCC 23445 / NCTC 10510)
A9M6E4 1.4e-46 151 58 1 122 3 BCAN_A1514 UPF0260 protein BCAN_A1514 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q8FZK4 1.4e-46 151 58 1 122 3 BR1477 UPF0260 protein BR1477/BS1330_I1471 Brucella suis biovar 1 (strain 1330)
Q2IUB0 2.74e-46 151 51 2 143 3 RPB_3505 UPF0260 protein RPB_3505 Rhodopseudomonas palustris (strain HaA2)
B8GNB7 4.39e-46 150 50 1 143 3 Tgr7_0887 UPF0260 protein Tgr7_0887 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q98IG7 5.91e-46 149 50 2 141 3 mll2411 UPF0260 protein mll2411 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1I6K6 5.85e-45 147 47 2 142 3 PSEEN4031 UPF0260 protein PSEEN4031 Pseudomonas entomophila (strain L48)
A8H5C4 1.17e-44 146 48 1 140 3 Spea_2441 UPF0260 protein Spea_2441 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q083H5 1.37e-44 146 47 1 144 3 Sfri_1740 UPF0260 protein Sfri_1740 Shewanella frigidimarina (strain NCIMB 400)
Q89QM1 1.95e-44 146 49 3 143 3 blr3103 UPF0260 protein blr3103 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A8FWA0 3.2e-44 145 48 1 140 3 Ssed_2516 UPF0260 protein Ssed_2516 Shewanella sediminis (strain HAW-EB3)
Q88E79 3.39e-44 145 50 2 140 3 PP_4587 UPF0260 protein PP_4587 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VA56 3.53e-44 145 48 1 141 3 Swit_2819 UPF0260 protein Swit_2819 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A1U123 3.92e-44 145 48 2 141 3 Maqu_1608 UPF0260 protein Maqu_1608 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
C1DPM9 4.51e-44 144 48 2 143 3 Avin_32930 UPF0260 protein Avin_32930 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B8E7F7 4.9e-44 144 47 1 141 3 Sbal223_2421 UPF0260 protein Sbal223_2421 Shewanella baltica (strain OS223)
A9KYY8 4.9e-44 144 47 1 141 3 Sbal195_1905 UPF0260 protein Sbal195_1905 Shewanella baltica (strain OS195)
A6WMK2 4.9e-44 144 47 1 141 3 Shew185_1898 UPF0260 protein Shew185_1898 Shewanella baltica (strain OS185)
A3D3R4 4.9e-44 144 47 1 141 3 Sbal_1871 UPF0260 protein Sbal_1871 Shewanella baltica (strain OS155 / ATCC BAA-1091)
A5W002 5.2e-44 144 48 2 142 3 Pput_1301 UPF0260 protein Pput_1301 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q07QF5 8.32e-44 144 48 3 143 3 RPE_1881 UPF0260 protein RPE_1881 Rhodopseudomonas palustris (strain BisA53)
Q3KGH1 8.78e-44 144 48 2 143 3 Pfl01_1392 UPF0260 protein Pfl01_1392 Pseudomonas fluorescens (strain Pf0-1)
B9JU16 1.09e-43 144 48 2 145 3 Avi_1324 UPF0260 protein Avi_1324 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
C3M8L8 1.38e-43 144 48 2 143 3 NGR_c07710 UPF0260 protein NGR_c07710 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B0KSS1 3.28e-43 142 48 2 142 3 PputGB1_4117 UPF0260 protein PputGB1_4117 Pseudomonas putida (strain GB-1)
Q1QNH1 5.41e-43 142 49 3 143 3 Nham_1404 UPF0260 protein Nham_1404 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B1KDK4 5.84e-43 142 45 1 140 3 Swoo_2117 UPF0260 protein Swoo_2117 Shewanella woodyi (strain ATCC 51908 / MS32)
Q5FR39 5.84e-43 142 47 1 143 3 GOX1406 UPF0260 protein GOX1406 Gluconobacter oxydans (strain 621H)
O68068 6.91e-43 142 49 2 139 3 RCAP_rcc02083 UPF0260 protein RCAP_rcc02083 Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
B0TRI6 8.75e-43 141 46 1 141 3 Shal_1839 UPF0260 protein Shal_1839 Shewanella halifaxensis (strain HAW-EB4)
Q92R94 9.04e-43 141 48 2 143 3 R01011 UPF0260 protein R01011 Rhizobium meliloti (strain 1021)
A4XT74 1.1e-42 141 46 2 144 3 Pmen_1776 UPF0260 protein Pmen_1776 Pseudomonas mendocina (strain ymp)
B3QAR0 1.22e-42 142 48 2 143 3 Rpal_2074 UPF0260 protein Rpal_2074 Rhodopseudomonas palustris (strain TIE-1)
Q02JE0 1.6e-42 140 46 2 143 3 PA14_47410 UPF0260 protein PA14_47410 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UW21 1.6e-42 140 46 2 143 3 PLES_38831 UPF0260 protein PLES_38831 Pseudomonas aeruginosa (strain LESB58)
Q9I445 1.6e-42 140 46 2 143 3 PA1299 UPF0260 protein PA1299 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4KGK7 1.71e-42 140 47 2 143 3 PFL_1499 UPF0260 protein PFL_1499 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48LC2 3.55e-42 140 47 2 143 3 PSPPH_1551 UPF0260 protein PSPPH_1551 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A6U753 4.9e-42 139 54 1 125 3 Smed_0627 UPF0260 protein Smed_0627 Sinorhizobium medicae (strain WSM419)
A6V8R1 8.98e-42 139 46 2 143 3 PSPA7_4092 UPF0260 protein PSPA7_4092 Pseudomonas aeruginosa (strain PA7)
Q217T7 1.16e-41 139 48 3 143 3 RPC_1790 UPF0260 protein RPC_1790 Rhodopseudomonas palustris (strain BisB18)
Q8UGV3 1.24e-41 139 49 2 143 3 Atu0932 UPF0260 protein Atu0932 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q4ZW57 1.33e-41 138 47 2 141 3 Psyr_1567 UPF0260 protein Psyr_1567 Pseudomonas syringae pv. syringae (strain B728a)
Q87Y85 1.55e-41 138 46 2 143 3 PSPTO_3918 UPF0260 protein PSPTO_3918 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9CN96 8.16e-41 136 46 3 140 3 PM0539 UPF0260 protein PM0539 Pasteurella multocida (strain Pm70)
B3PKG8 1.79e-40 135 48 2 140 3 CJA_2436 UPF0260 protein CJA_2436 Cellvibrio japonicus (strain Ueda107)
B0SW01 2.77e-40 135 47 1 138 3 Caul_3920 UPF0260 protein Caul_3920 Caulobacter sp. (strain K31)
Q4QK65 3.03e-40 135 46 3 141 3 NTHI1811 UPF0260 protein NTHI1811 Haemophilus influenzae (strain 86-028NP)
Q0A8V6 3.8e-40 135 49 1 128 3 Mlg_1382 UPF0260 protein Mlg_1382 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A7HRI8 4.81e-40 134 45 2 144 3 Plav_0898 UPF0260 protein Plav_0898 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A5UBW4 7.59e-40 134 46 3 141 3 CGSHiEE_04300 UPF0260 protein CGSHiEE_04300 Haemophilus influenzae (strain PittEE)
A5UEJ1 7.59e-40 134 46 3 141 3 CGSHiGG_00425 UPF0260 protein CGSHiGG_00425 Haemophilus influenzae (strain PittGG)
P44168 8.1e-40 134 46 3 141 3 HI_1355 UPF0260 protein HI_1355 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C3K5F5 1.86e-39 133 46 2 143 3 PFLU_1520 UPF0260 protein PFLU_1520 Pseudomonas fluorescens (strain SBW25)
B8H4M6 4.56e-39 132 46 1 138 3 CCNA_03385 UPF0260 protein CCNA_03385 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A3C8 4.56e-39 132 46 1 138 3 CC_3276 UPF0260 protein CC_3276 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_01350
Feature type CDS
Gene ycgN
Product YcgN family cysteine cluster protein
Location 248705 - 249151 (strand: 1)
Length 447 (nucleotides) / 148 (amino acids)
In genomic island -

Contig

Accession ZDB_679
Length 398279 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_731
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03692 Putative zinc- or iron-chelating domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2983 General function prediction only (R) R Uncharacterized cysteine cluster protein YcgN, CxxCxxCC family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09160 uncharacterized protein - -

Protein Sequence

MSQPFWTVKTLDEMSDEEWESLCDGCGQCCLQKLMDADTDEIYFTDVACNQLDIKSCQCRHYEDRFRYEPDCIKLTRENLPTFDAWLPMTCAYRLVMEGKPLLPWHPLISGSKSLMHQKGITVRHIAVTESVVQNWEDHILNKPEGGL

Flanking regions ( +/- flanking 50bp)

ACGCGGATTATCTGAAACGGGTCAGCCACGAAGTAAAAGGAAAAAAGAACATGTCTCAACCATTCTGGACGGTGAAAACCCTCGATGAAATGAGTGACGAAGAGTGGGAATCACTGTGTGATGGCTGCGGGCAATGCTGTTTGCAGAAACTGATGGACGCAGACACTGATGAAATTTATTTCACCGATGTGGCCTGCAACCAGCTGGATATTAAAAGCTGCCAGTGCCGTCATTATGAAGACCGTTTCCGCTATGAACCGGACTGCATCAAACTGACGCGGGAAAACCTGCCGACATTTGACGCCTGGCTGCCGATGACCTGTGCTTACCGCCTGGTCATGGAAGGCAAACCGTTATTACCCTGGCACCCGCTAATCAGCGGATCCAAATCCCTGATGCACCAGAAGGGCATTACCGTCCGCCACATAGCCGTCACCGAAAGCGTGGTACAGAACTGGGAAGACCATATCCTGAATAAGCCCGAAGGCGGGTTATAACTGATTGTTTACAACGCGGGACATAGATGGGGCATTTTGCGCTGACGTGC