Homologs in group_3495

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17085 FBDBKF_17085 100.0 Morganella morganii S1 - DUF2116 domain-containing protein
EHELCC_01805 EHELCC_01805 100.0 Morganella morganii S2 - DUF2116 domain-containing protein
NLDBIP_01655 NLDBIP_01655 100.0 Morganella morganii S4 - DUF2116 domain-containing protein
LHKJJB_00380 LHKJJB_00380 100.0 Morganella morganii S3 - DUF2116 domain-containing protein

Distribution of the homologs in the orthogroup group_3495

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3495

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_00420
Feature type CDS
Gene -
Product DUF2116 domain-containing protein
Location 71988 - 72185 (strand: -1)
Length 198 (nucleotides) / 65 (amino acids)

Contig

Accession ZDB_679
Length 398279 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3495
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MADIIDEANDLNELRLTTALANRPPKPQSLTGFCIWCRDEPIMPGSAYCSKECGDDDAQNKRKNG

Flanking regions ( +/- flanking 50bp)

GGATGTGTACGGGGATCAGGTTAACAGTGACATACAACTGAGGTAATTTTATGGCCGATATTATCGATGAAGCCAATGACTTAAACGAACTGCGACTGACTACCGCTCTTGCCAACCGGCCACCGAAGCCGCAGAGCCTGACCGGCTTCTGTATCTGGTGCCGTGATGAACCGATTATGCCCGGCAGCGCGTACTGCTCAAAAGAGTGCGGCGACGATGACGCACAGAACAAGCGCAAAAACGGATAGGAGGCACTGATGCTGATCCTTGCACTCTATCTGTGGATTGCCGGTTATCT