Homologs in group_3498

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_01805 EHELCC_01805 100.0 Morganella morganii S2 - DUF2116 domain-containing protein
NLDBIP_01655 NLDBIP_01655 100.0 Morganella morganii S4 - DUF2116 domain-containing protein
LHKJJB_00380 LHKJJB_00380 100.0 Morganella morganii S3 - DUF2116 domain-containing protein
HKOGLL_00420 HKOGLL_00420 100.0 Morganella morganii S5 - DUF2116 domain-containing protein

Distribution of the homologs in the orthogroup group_3498

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3498

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_17085
Feature type CDS
Gene -
Product DUF2116 domain-containing protein
Location 1376 - 1573 (strand: 1)
Length 198 (nucleotides) / 65 (amino acids)
In genomic island -

Contig

Accession contig_27
Length 46634 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3498
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MADIIDEANDLNELRLTTALANRPPKPQSLTGFCIWCRDEPIMPGSAYCSKECGDDDAQNKRKNG

Flanking regions ( +/- flanking 50bp)

GGATGTGTACGGGGATCAGGTTAACAGTGACATACAACTGAGGTAATTTTATGGCCGATATTATCGATGAAGCCAATGACTTAAACGAACTGCGACTGACTACCGCTCTTGCCAACCGGCCACCGAAGCCGCAGAGCCTGACCGGCTTCTGTATCTGGTGCCGTGATGAACCGATTATGCCCGGCAGCGCGTACTGCTCAAAAGAGTGCGGCGACGATGACGCACAGAACAAGCGCAAAAACGGATAGGAGGCACTGATGCTGATCCTTGCACTCTATCTGTGGATTGCCGGTTATCT