Homologs in group_2452

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_19820 EHELCC_19820 100.0 Morganella morganii S2 - putative poly(Glycerol-phosphate) alpha-glucosyltransferase
NLDBIP_15040 NLDBIP_15040 100.0 Morganella morganii S4 - putative poly(Glycerol-phosphate) alpha-glucosyltransferase
LHKJJB_15570 LHKJJB_15570 100.0 Morganella morganii S3 - putative poly(Glycerol-phosphate) alpha-glucosyltransferase
HKOGLL_14690 HKOGLL_14690 100.0 Morganella morganii S5 - putative poly(Glycerol-phosphate) alpha-glucosyltransferase
F4V73_RS17340 F4V73_RS17340 26.3 Morganella psychrotolerans - glycosyltransferase family 4 protein
PMI_RS15620 PMI_RS15620 23.0 Proteus mirabilis HI4320 - glycosyltransferase family 4 protein

Distribution of the homologs in the orthogroup group_2452

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2452

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O05083 2.28e-33 130 28 7 364 3 HI_1698 Uncharacterized glycosyltransferase HI_1698 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q46634 5.46e-19 90 21 11 367 3 amsD Amylovoran biosynthesis glycosyltransferase AmsD Erwinia amylovora
Q9R9N1 6.11e-16 81 27 4 209 3 lpsE Lipopolysaccharide core biosynthesis glycosyltransferase LpsE Rhizobium meliloti (strain 1021)
Q0P9C9 9.56e-16 81 30 3 178 1 pglA N,N'-diacetylbacillosaminyl-diphospho-undecaprenol alpha-1,3-N-acetylgalactosaminyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9L1I4 2.92e-15 80 26 4 192 3 SCO2592 Exopolysaccharide phosphotransferase SCO2592 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q0P9C5 2e-14 77 22 14 358 1 pglH GalNAc-alpha-(1->4)-GalNAc-alpha-(1->3)-diNAcBac-PP-undecaprenol alpha-1,4-N-acetyl-D-galactosaminyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q58459 4.58e-14 76 28 7 252 3 MJ1059 Uncharacterized glycosyltransferase MJ1059 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q58577 1.32e-11 68 31 2 144 3 MJ1178 Uncharacterized glycosyltransferase MJ1178 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q0P9C7 1.56e-11 68 27 4 181 1 pglJ N-acetylgalactosamine-N,N'-diacetylbacillosaminyl-diphospho-undecaprenol 4-alpha-N-acetylgalactosaminyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q4JSW2 3.52e-11 67 27 4 158 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium jeikeium (strain K411)
P39862 1.33e-10 65 27 2 163 3 capM Capsular polysaccharide biosynthesis glycosyltransferase CapM Staphylococcus aureus
Q59002 2e-10 65 26 3 155 3 MJ1607 Uncharacterized glycosyltransferase MJ1607 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
B5T072 2.02e-10 65 30 7 192 1 wclR UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol alpha-1,3-galactosyltransferase Escherichia coli
C3PK12 8.35e-10 63 24 6 235 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q65CC7 1.37e-09 62 25 2 184 1 kanE Alpha-D-kanosaminyltransferase Streptomyces kanamyceticus
P54490 2.12e-09 62 23 7 239 3 yqgM Uncharacterized glycosyltransferase YqgM Bacillus subtilis (strain 168)
A8LZG1 2.61e-09 62 24 5 174 3 mshA D-inositol 3-phosphate glycosyltransferase Salinispora arenicola (strain CNS-205)
A0R2E2 4.66e-09 60 27 8 184 1 glgM Alpha-maltose-1-phosphate synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q4H4F8 5.27e-09 60 25 1 159 3 btrM 2-deoxystreptamine N-acetyl-D-glucosaminyltransferase Niallia circulans
C4LLD6 5.77e-09 60 26 4 165 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
P71053 8.99e-09 60 25 1 146 2 epsD Putative glycosyltransferase EpsD Bacillus subtilis (strain 168)
P26388 9.99e-09 60 24 2 139 3 wcaL Putative colanic acid biosynthesis glycosyltransferase WcaL Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B1VEI4 2.19e-08 58 25 5 168 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
P13484 4.64e-08 58 23 5 250 1 tagE Poly(glycerol-phosphate) alpha-glucosyltransferase Bacillus subtilis (strain 168)
A1SP12 7.67e-08 57 20 4 177 3 mshA D-inositol 3-phosphate glycosyltransferase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q81ST7 1.02e-07 57 24 3 172 1 bshA N-acetyl-alpha-D-glucosaminyl L-malate synthase Bacillus anthracis
D5USX8 1.07e-07 57 22 5 177 3 mshA D-inositol 3-phosphate glycosyltransferase Tsukamurella paurometabola (strain ATCC 8368 / DSM 20162 / CCUG 35730 / CIP 100753 / JCM 10117 / KCTC 9821 / NBRC 16120 / NCIMB 702349 / NCTC 13040)
A0QWG6 1.36e-07 56 23 5 172 1 pimA Phosphatidyl-myo-inositol mannosyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
O68547 1.47e-07 56 27 3 181 3 lpcC Lipopolysaccharide core biosynthesis mannosyltransferase LpcC Rhizobium leguminosarum bv. viciae
D3Q051 1.7e-07 56 20 7 237 3 mshA D-inositol 3-phosphate glycosyltransferase Stackebrandtia nassauensis (strain DSM 44728 / CIP 108903 / NRRL B-16338 / NBRC 102104 / LLR-40K-21)
Q46638 1.78e-07 56 26 3 147 3 amsK Amylovoran biosynthesis glycosyltransferase AmsK Erwinia amylovora
A4X1R6 1.82e-07 56 22 5 175 3 mshA D-inositol 3-phosphate glycosyltransferase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A0LQY9 2.22e-07 55 24 7 181 3 mshA D-inositol 3-phosphate glycosyltransferase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
P71243 2.26e-07 55 25 2 129 3 wcaL Putative colanic acid biosynthesis glycosyltransferase WcaL Escherichia coli (strain K12)
P87172 2.81e-07 55 24 8 236 3 gpi3 Phosphatidylinositol N-acetylglucosaminyltransferase gpi3 subunit Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q5YP47 3.48e-07 55 22 4 172 3 mshA D-inositol 3-phosphate glycosyltransferase Nocardia farcinica (strain IFM 10152)
Q65CC1 4.3e-07 55 21 5 178 1 kanF 2-deoxystreptamine glucosyltransferase Streptomyces kanamyceticus
A3PU84 4.66e-07 55 24 5 162 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium sp. (strain JLS)
B8HCF8 4.75e-07 55 24 4 146 3 mshA D-inositol 3-phosphate glycosyltransferase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
B1MHQ0 4.91e-07 55 25 5 154 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q0SF06 5.02e-07 55 22 4 183 3 mshA D-inositol 3-phosphate glycosyltransferase Rhodococcus jostii (strain RHA1)
Q1BEA6 7.28e-07 54 24 5 155 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium sp. (strain MCS)
A1UAM8 7.28e-07 54 24 5 155 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium sp. (strain KMS)
A0JZ09 1.31e-06 53 25 5 160 3 mshA D-inositol 3-phosphate glycosyltransferase Arthrobacter sp. (strain FB24)
P9WMY9 1.65e-06 53 25 2 138 1 Rv3032 Glycogen synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMY8 1.65e-06 53 25 2 138 3 MT3116 Glycogen synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A8LDJ8 1.65e-06 53 23 6 172 3 mshA D-inositol 3-phosphate glycosyltransferase Parafrankia sp. (strain EAN1pec)
Q9R9N0 2.16e-06 52 25 4 172 3 lpsD Lipopolysaccharide core biosynthesis glycosyltransferase LpsD Rhizobium meliloti (strain 1021)
C0ZUT0 2.41e-06 52 24 4 173 3 mshA D-inositol 3-phosphate glycosyltransferase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q8NNK8 3.96e-06 52 24 9 234 1 pimB GDP-mannose-dependent monoacylated alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
C7R101 5.63e-06 51 21 7 232 3 mshA D-inositol 3-phosphate glycosyltransferase Jonesia denitrificans (strain ATCC 14870 / DSM 20603 / BCRC 15368 / CIP 55.134 / JCM 11481 / NBRC 15587 / NCTC 10816 / Prevot 55134)
Q8S4F6 5.68e-06 51 24 3 163 1 SQD2 Sulfoquinovosyl transferase SQD2 Arabidopsis thaliana
C8XA09 9.26e-06 50 21 4 172 3 mshA D-inositol 3-phosphate glycosyltransferase Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / CIP 104796 / JCM 9543 / NBRC 105858 / Y-104)
P39859 9.78e-06 50 25 6 186 4 capJ Protein CapJ Staphylococcus aureus
Q04975 1.56e-05 50 25 1 106 4 vipC Vi polysaccharide biosynthesis protein VipC/TviE Salmonella typhi
Q8NT41 1.62e-05 50 24 2 158 1 mgtA GDP-mannose-dependent alpha-mannosyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q47KS6 1.7e-05 50 20 4 163 3 mshA D-inositol 3-phosphate glycosyltransferase Thermobifida fusca (strain YX)
O32272 2.57e-05 49 28 5 147 2 tuaC Putative teichuronic acid biosynthesis glycosyltransferase TuaC Bacillus subtilis (strain 168)
Q6NJL3 2.8e-05 49 24 6 157 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q06994 3.89e-05 48 26 6 171 1 waaB Lipopolysaccharide 1,6-galactosyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q0JGK4 5.27e-05 48 34 0 63 2 SPS1 Probable sucrose-phosphate synthase 1 Oryza sativa subsp. japonica
A2WYE9 5.27e-05 48 34 0 63 2 SPS1 Probable sucrose-phosphate synthase 1 Oryza sativa subsp. indica
C1AZ64 5.39e-05 48 22 4 153 3 mshA D-inositol 3-phosphate glycosyltransferase Rhodococcus opacus (strain B4)
Q8NTA6 6.01e-05 48 24 4 153 1 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QB40 6.01e-05 48 24 4 153 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium glutamicum (strain R)
A1R8N8 8.43e-05 47 20 4 158 3 mshA D-inositol 3-phosphate glycosyltransferase Paenarthrobacter aurescens (strain TC1)
A0A0H2WWV6 8.62e-05 48 28 2 144 1 tarM Poly(ribitol-phosphate) alpha-N-acetylglucosaminyltransferase Staphylococcus aureus (strain COL)
P46915 8.94e-05 47 24 7 178 1 cotSA Spore coat protein SA Bacillus subtilis (strain 168)
O34413 0.000131 47 26 7 162 3 ytcC Putative glycosyltransferase YtcC Bacillus subtilis (strain 168)
P31927 0.000135 47 34 1 72 1 SPS Sucrose-phosphate synthase Zea mays
Q9R9N2 0.000159 47 23 3 155 3 lpsB Lipopolysaccharide core biosynthesis mannosyltransferase LpsB Rhizobium meliloti (strain 1021)
P27127 0.000172 46 25 5 174 1 waaB Lipopolysaccharide 1,6-galactosyltransferase Escherichia coli (strain K12)
Q94BT0 0.000444 46 30 0 71 1 SPS1 Sucrose-phosphate synthase 1 Arabidopsis thaliana
Q58469 0.000619 45 26 10 253 3 MJ1069 Uncharacterized glycosyltransferase MJ1069 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8RY24 0.000659 45 30 0 72 2 SPS3 Probable sucrose-phosphate synthase 3 Arabidopsis thaliana
D4GU62 0.000665 45 21 8 276 3 agl9 Low-salt glycan biosynthesis hexosyltransferase Agl9 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P25740 0.000691 45 24 5 165 1 waaG Lipopolysaccharide glucosyltransferase WaaG Escherichia coli (strain K12)
Q9AET5 0.000838 45 22 3 171 1 gtfA UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase GtfA subunit Streptococcus gordonii
I7A3T6 0.001 45 32 0 64 1 MROS_1314 Sucrose synthase Melioribacter roseus (strain JCM 17771 / P3M-2)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_20615
Feature type CDS
Gene -
Product putative poly(Glycerol-phosphate) alpha-glucosyltransferase
Location 1100 - 2188 (strand: 1)
Length 1089 (nucleotides) / 362 (amino acids)

Contig

Accession contig_66
Length 2213 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2452
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00534 Glycosyl transferases group 1

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0438 Cell wall/membrane/envelope biogenesis (M) M Glycosyltransferase involved in cell wall bisynthesis

Protein Sequence

MKKDIVFLTESMVGAGGVVRVITTWANYFSTHGYKCKIISVVKGEPYFPLHEGIQFKIKTFFFKWKLLSLPLNLLAIIPILKECKNSILVVNKSAYIEPIYILRKLGLFKDIQLVYFSHGGNAEFELFYMSRLFTRHRVKMIFSVFDNVVCLFKNTDTTPECVIDEKITFIANPCPLEIYKRDLSQENKTVSFIGRVTKEKGVDTLIKSWKKIESEHPDWKLSIIGDGKDKTNFITLASELNLRNISFLPSTNDISKYLKETTISVLPSLFEGMPMSIIEARSQGCALVSTSTNGGIKLIDNLKNGLLVNINDTYDLTEKINQLITDKNLRNALILQGYDDALNYDIQVIANNWKGILGYDL

Flanking regions ( +/- flanking 50bp)

CAGCAAGCTTATCTACGACTATATTGTAAATAACCTTAGAAATAAATAATATGAAAAAAGATATTGTTTTCCTGACAGAAAGTATGGTTGGTGCTGGTGGTGTTGTCAGGGTTATAACAACATGGGCTAACTATTTCAGTACACATGGATATAAGTGTAAAATAATCTCTGTTGTTAAAGGCGAACCTTATTTTCCTTTACACGAAGGTATTCAATTTAAGATTAAGACATTCTTTTTTAAATGGAAACTACTTTCACTTCCTTTAAATCTACTGGCAATAATCCCAATATTAAAAGAGTGCAAAAACTCAATATTAGTTGTCAATAAGTCTGCGTATATCGAACCTATTTATATTCTCAGGAAGTTAGGGTTATTTAAAGATATTCAGCTGGTATATTTCTCTCACGGCGGCAATGCTGAATTTGAATTATTTTACATGTCCAGATTATTCACCAGACATCGTGTAAAAATGATCTTTTCAGTATTTGATAATGTAGTGTGTTTATTTAAAAATACAGATACAACTCCTGAATGCGTTATAGATGAGAAAATTACATTTATTGCTAATCCATGCCCACTTGAAATATATAAAAGAGACCTATCTCAGGAGAATAAAACGGTATCATTTATTGGCCGAGTCACGAAAGAAAAAGGTGTAGATACTTTAATTAAGTCCTGGAAAAAAATAGAAAGTGAACATCCTGATTGGAAATTATCAATAATTGGTGATGGTAAAGATAAAACTAATTTCATAACACTTGCAAGTGAATTAAACTTAAGAAATATCAGTTTCCTTCCTTCTACTAATGATATCAGTAAATATTTGAAAGAGACTACCATTAGTGTTCTTCCCTCTCTATTTGAAGGAATGCCAATGAGTATAATTGAAGCTCGTTCCCAAGGGTGTGCCTTAGTATCGACAAGTACTAACGGTGGAATAAAGCTAATTGATAATTTAAAAAATGGATTACTCGTAAATATAAATGATACATACGATTTAACTGAAAAAATAAATCAACTTATCACTGATAAAAACCTACGTAACGCATTGATTTTACAGGGTTATGATGACGCTCTAAATTATGATATTCAGGTAATCGCAAACAACTGGAAAGGTATACTTGGATATGATTTATGAGTACTCCCCACTATTTATTATAAT