Homologs in group_3779
1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| EHELCC_19600 | EHELCC_19600 | 100.0 | Morganella morganii S2 | tnpR | Transposon Tn1331 resolvase |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| P0ADI3 | 1.21e-128 | 361 | 98 | 0 | 185 | 3 | tnpR | Transposon Tn3 resolvase | Klebsiella pneumoniae |
| P0ADI2 | 1.21e-128 | 361 | 98 | 0 | 185 | 1 | tnpR | Transposon Tn3 resolvase | Escherichia coli |
| P21424 | 3.71e-128 | 360 | 97 | 0 | 185 | 3 | tnpR | Transposon Tn1331 resolvase | Klebsiella pneumoniae |
| P13606 | 1.2e-113 | 324 | 88 | 0 | 182 | 3 | tnpR | R46 site-specific recombinase | Escherichia coli |
| P03012 | 1.08e-105 | 303 | 81 | 0 | 181 | 1 | tnpR | Transposon gamma-delta resolvase | Escherichia coli (strain K12) |
| P30739 | 3.37e-93 | 271 | 75 | 0 | 179 | 3 | None | Resolvase/recombinase | Pseudomonas putida |
| P19241 | 6.64e-33 | 119 | 37 | 3 | 181 | 3 | resR | Transposon Tn552 DNA-invertase BinR | Staphylococcus aureus |
| P18358 | 9.22e-33 | 119 | 38 | 4 | 190 | 3 | tnpR | Transposon Tn552 resolvase | Staphylococcus aureus |
| P07945 | 2.32e-31 | 115 | 35 | 2 | 184 | 3 | res | Resolvase | Clostridium perfringens |
| P03015 | 6.16e-28 | 106 | 37 | 2 | 185 | 1 | gin | Serine recombinase gin | Escherichia phage Mu |
| Q93MD2 | 7.52e-28 | 106 | 34 | 3 | 184 | 3 | res | Resolvase | Clostridium perfringens (strain 13 / Type A) |
| P03013 | 7.97e-28 | 106 | 36 | 2 | 186 | 1 | hin | DNA-invertase hin | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| Q38199 | 1.99e-27 | 105 | 38 | 2 | 178 | 2 | gin | Serine recombinase gin | Escherichia phage D108 |
| Q02869 | 2.19e-27 | 105 | 36 | 2 | 186 | 3 | hin | DNA-invertase | Salmonella abortus-equi |
| P21703 | 3.49e-27 | 104 | 38 | 4 | 179 | 3 | cin | DNA-invertase | Enterobacteria phage P7 |
| P10311 | 4.1e-27 | 104 | 38 | 4 | 179 | 3 | cin | DNA-invertase | Escherichia phage P1 |
| P03014 | 9.92e-27 | 103 | 37 | 2 | 178 | 3 | pinE | Serine recombinase PinE | Escherichia coli (strain K12) |
| P06693 | 7.38e-26 | 100 | 32 | 2 | 185 | 3 | tnpR | Transposon Tn917 resolvase | Enterococcus faecalis |
| P0C1G3 | 4.12e-25 | 99 | 32 | 3 | 181 | 3 | tnpR | Transposons Tn4653 resolvase | Pseudomonas putida |
| P0C1G2 | 4.12e-25 | 99 | 32 | 3 | 181 | 3 | tnpR | Transposons Tn1721 resolvase | Escherichia coli |
| P06691 | 4.4e-25 | 99 | 32 | 3 | 181 | 3 | tnpR | Transposon Tn501 resolvase | Pseudomonas aeruginosa |
| P04130 | 2.05e-23 | 94 | 32 | 3 | 181 | 3 | tnpR | Transposon Tn21 resolvase | Escherichia coli |
| P05823 | 2.93e-23 | 94 | 31 | 4 | 192 | 3 | tnpR | Transposon Tn2501 resolvase | Escherichia coli |
| P0ADI0 | 3.55e-22 | 91 | 31 | 4 | 184 | 1 | pinR | Serine recombinase PinR | Escherichia coli (strain K12) |
| P0ADI1 | 3.55e-22 | 91 | 31 | 4 | 184 | 3 | pinR | Putative DNA-invertase from lambdoid prophage Rac | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| P55389 | 2.48e-21 | 91 | 41 | 1 | 136 | 3 | NGR_a00070 | Probable DNA-invertase y4cG | Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
| P77170 | 1.02e-20 | 87 | 30 | 4 | 184 | 3 | pinQ | Serine recombinase PinQ | Escherichia coli (strain K12) |
| P20384 | 7.31e-19 | 83 | 31 | 6 | 203 | 1 | bin3 | Putative transposon Tn552 DNA-invertase bin3 | Staphylococcus aureus |
| Q06237 | 1.27e-17 | 79 | 28 | 5 | 190 | 3 | None | Transposon Tn1546 resolvase | Enterococcus faecium |
| P55559 | 1.35e-16 | 76 | 30 | 2 | 179 | 3 | NGR_a02590 | Integrase-like protein y4lS | Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
| P18957 | 6.23e-12 | 64 | 28 | 6 | 187 | 3 | uvp1 | Protein uvp1 | Escherichia coli |
| P17867 | 4.78e-07 | 52 | 28 | 7 | 162 | 3 | cisA | Putative DNA recombinase | Bacillus subtilis (strain 168) |
| P22996 | 2.98e-06 | 49 | 29 | 9 | 198 | 3 | parA | Resolvase | Escherichia coli |
| Q45057 | 0.000753 | 42 | 33 | 6 | 131 | 2 | yneB | Resolvase homolog YneB | Bacillus subtilis (strain 168) |
| Source | Morganella morganii S1 |
|---|---|
| Locus tag | FBDBKF_20235 |
| Feature type | CDS |
| Gene | tnpR |
| Product | Transposon Tn1331 resolvase |
| Location | 4471 - 5028 (strand: -1) |
| Length | 558 (nucleotides) / 185 (amino acids) |
| Accession | contig_49 |
|---|---|
| Length | 10748 nucleotides |
| Topology | linear |
| Plasmid | False |
| Orthogroup | group_3779 | |
|---|---|---|
| Orthogroup size | 2 | |
| N. genomes | 2 |
| ID | Function(s) descr. | Function(s) cat. | Description |
|---|---|---|---|
| COG1961 | Replication, recombination and repair (L) | L | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE |
| KO | Description | Pathways | Modules |
|---|---|---|---|
| K14060 | putative DNA-invertase from lambdoid prophage Rac | - | - |
MRLFGYARVSTSQQSLDLQVRALKDAGVKANRIFTDKASGSSTDREGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVAVRFIDDGISTDGDMGQMVVTILSAVAQAERRRILERTNEGRQEAKLKGIKFGRRRTVDRNVVLTLHQKGTGATEIAHQLSIARSTVYKILEDERAS
TTGTAATAATAGACATGAGTTGTCCGATATTCGATTTAAGGTACATTTTTATGCGACTTTTTGGTTACGCTCGGGTCTCAACCAGTCAGCAGTCTCTTGATCTTCAGGTCAGAGCACTCAAAGACGCAGGTGTGAAAGCAAACCGTATATTTACCGATAAGGCATCCGGCAGTTCAACAGACCGGGAAGGGCTGGATTTGCTGAGGATGAAGGTGGAGGAAGGTGATGTCATTCTGGTTAAGAAGCTCGACCGTCTTGGCCGCGACACTGCCGATATGATCCAACTGATAAAGGAATTTGACGCTCAGGGCGTGGCAGTCCGGTTCATTGATGACGGGATCAGTACCGACGGTGATATGGGGCAAATGGTGGTCACCATCCTGTCGGCTGTGGCACAGGCTGAACGCCGGAGGATCCTAGAACGCACGAATGAGGGCCGACAGGAAGCAAAGCTGAAAGGAATCAAATTTGGCCGCAGGCGTACCGTGGACAGGAACGTCGTGCTGACGCTTCATCAGAAGGGCACTGGTGCAACGGAAATTGCTCATCAGCTCAGTATTGCCCGCTCCACGGTTTATAAAATTCTTGAAGACGAAAGGGCCTCGTGATACGCCTATTTTTATAGGTTAATGTCATGATAATAATGGTTTCTTAGACG
