Homologs in group_3118

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_07645 EHELCC_07645 100.0 Morganella morganii S2 yegP UPF0339 protein
NLDBIP_07970 NLDBIP_07970 100.0 Morganella morganii S4 yegP UPF0339 protein
LHKJJB_06295 LHKJJB_06295 100.0 Morganella morganii S3 yegP UPF0339 protein
HKOGLL_19150 HKOGLL_19150 100.0 Morganella morganii S5 yegP UPF0339 protein
F4V73_RS02400 F4V73_RS02400 95.1 Morganella psychrotolerans - YegP family protein

Distribution of the homologs in the orthogroup group_3118

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3118

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZCV6 2.5e-16 69 63 1 58 3 yegP UPF0339 protein YegP Yersinia pestis
Q8ZCV6 1.63e-12 60 58 1 55 3 yegP UPF0339 protein YegP Yersinia pestis
Q8EAL4 8.04e-15 65 61 1 54 1 SO_3888 UPF0339 protein SO_3888 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8EAL4 1.98e-10 54 59 0 44 1 SO_3888 UPF0339 protein SO_3888 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7VSB4 1.92e-11 57 56 1 55 3 BP0521 UPF0339 protein BP0521 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7VSB4 9.36e-06 42 50 0 44 3 BP0521 UPF0339 protein BP0521 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WQ88 1.92e-11 57 56 1 55 3 BB0445 UPF0339 protein BB0445 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7WQ88 9.36e-06 42 50 0 44 3 BB0445 UPF0339 protein BB0445 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7WC84 1.92e-11 57 56 1 55 3 BPP0444 UPF0339 protein BPP0444 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WC84 9.36e-06 42 50 0 44 3 BPP0444 UPF0339 protein BPP0444 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P76402 2.28e-11 57 53 1 54 1 yegP UPF0339 protein YegP Escherichia coli (strain K12)
P76402 3.02e-11 56 55 0 45 1 yegP UPF0339 protein YegP Escherichia coli (strain K12)
Q8FG00 2.46e-11 57 53 1 54 3 yegP UPF0339 protein YegP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FG00 6.19e-11 55 55 0 45 3 yegP UPF0339 protein YegP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q83KI3 2.57e-11 57 53 1 54 3 yegP UPF0339 protein YegP Shigella flexneri
Q83KI3 3.33e-11 56 55 0 45 3 yegP UPF0339 protein YegP Shigella flexneri
Q8X7I0 3.3e-11 56 55 0 45 3 yegP UPF0339 protein YegP Escherichia coli O157:H7
Q8X7I0 4.52e-11 56 53 1 54 3 yegP UPF0339 protein YegP Escherichia coli O157:H7
Q6FE77 5.68e-11 55 56 2 55 3 ACIAD0721 UPF0339 protein ACIAD0721 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q6FE77 1.75e-10 54 48 1 58 3 ACIAD0721 UPF0339 protein ACIAD0721 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q7N3D8 7.2e-11 55 54 2 55 3 plu2779 UPF0339 protein plu2779 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N3D8 6.96e-05 40 45 0 44 3 plu2779 UPF0339 protein plu2779 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9CNB3 8.85e-11 55 54 2 55 3 PM0519 UPF0339 protein PM0519 Pasteurella multocida (strain Pm70)
Q9CNB3 3.39e-10 53 50 1 58 3 PM0519 UPF0339 protein PM0519 Pasteurella multocida (strain Pm70)
Q65TL1 1.77e-10 54 54 2 55 3 MS1092 UPF0339 protein MS1092 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q65TL1 7.55e-10 53 44 1 58 3 MS1092 UPF0339 protein MS1092 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q73PH3 8.81e-10 51 46 0 50 3 TDE_0826 UPF0339 protein TDE_0826 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q8TKT0 7.36e-06 41 43 0 46 3 MA_3316 UPF0339 protein MA_3316 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
O69049 1.42e-05 42 42 0 45 3 None UPF0339 protein in ptx operon 5'region Stutzerimonas stutzeri
O69049 1.47e-05 42 44 1 50 3 None UPF0339 protein in ptx operon 5'region Stutzerimonas stutzeri
Q9I6G2 1.56e-05 42 50 2 48 3 PA0329 UPF0339 protein PA0329 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I6G2 0.000437 38 32 1 58 3 PA0329 UPF0339 protein PA0329 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9A478 0.000225 38 50 1 44 3 CC_2965 UPF0339 protein CC_2965 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q98DI0 0.000433 37 42 0 35 3 msl4696 UPF0339 protein Msl4696 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q9JRE9 0.000468 37 36 0 50 3 NMA1193 UPF0339 protein NMA1193/NMA1859 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q7DDI1 0.000468 37 36 0 50 1 NMB1088 UPF0339 protein NMB1088 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_19970
Feature type CDS
Gene yegP
Product UPF0339 protein
Location 12178 - 12363 (strand: -1)
Length 186 (nucleotides) / 61 (amino acids)
In genomic island -

Contig

Accession contig_45
Length 15421 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3118
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF07411 Domain of unknown function (DUF1508)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3422 Function unknown (S) S Uncharacterized conserved protein YegP, UPF0339 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09946 uncharacterized protein - -

Protein Sequence

MGYYELKKSTKDTPQPYYFVLKAGNHEIIATSEMYASKQGAMNGIASVQKNGPSEVIKDLT

Flanking regions ( +/- flanking 50bp)

CGTCATTATGATTTGCCGTATTAACATGATTTTCAACCGAGGAGCTTGTTATGGGGTATTACGAGTTAAAAAAATCGACCAAAGATACACCGCAGCCGTACTATTTCGTTCTGAAAGCCGGAAACCATGAAATTATCGCCACCAGCGAAATGTATGCCTCAAAGCAGGGGGCAATGAATGGTATCGCGTCTGTACAGAAAAATGGCCCTTCTGAAGTGATTAAAGATCTGACCTGATCAATAAGCAACAGATTTATTAAGGCCCCTGAGCACATCAGCGGGCCTTT