Homologs in group_3114

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_10870 EHELCC_10870 100.0 Morganella morganii S2 - Amino acid decarboxylase
NLDBIP_11215 NLDBIP_11215 100.0 Morganella morganii S4 - Amino acid decarboxylase
LHKJJB_10140 LHKJJB_10140 100.0 Morganella morganii S3 - Amino acid decarboxylase
HKOGLL_16305 HKOGLL_16305 100.0 Morganella morganii S5 - Amino acid decarboxylase
PMI_RS12935 PMI_RS12935 100.0 Proteus mirabilis HI4320 - Orn/Lys/Arg decarboxylase N-terminal domain-containing protein

Distribution of the homologs in the orthogroup group_3114

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3114

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P24169 4.7e-08 52 31 0 83 1 speF Inducible ornithine decarboxylase Escherichia coli (strain K12)
P21169 9.86e-07 48 26 1 103 1 speC Constitutive ornithine decarboxylase Escherichia coli (strain K12)
P44317 6.04e-06 46 31 1 85 3 speF Ornithine decarboxylase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_19775
Feature type CDS
Gene -
Product Amino acid decarboxylase
Location 18527 - 18838 (strand: -1)
Length 312 (nucleotides) / 103 (amino acids)
In genomic island -

Contig

Accession contig_43
Length 19499 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3114
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF03709 Orn/Lys/Arg decarboxylase, N-terminal domain

Protein Sequence

MKNYKVAVSYDMSDSISTHRKYVNILHTDFSYIAAIIISLDNIQDGRLDFIEQNSFGQPVFAIINKDKVIPTNIINRLTGVIDLNKKNTDRIQPAVPRLTDNI

Flanking regions ( +/- flanking 50bp)

TATTTTCACTTAATATTTCAGCAAGATTTTTTACCAAAAAGGAATTAAAAATGAAAAATTATAAAGTCGCAGTCAGCTATGATATGTCTGACTCTATTTCAACTCATCGTAAATATGTTAATATTCTACATACTGACTTCTCTTATATTGCCGCAATTATTATTTCACTTGATAATATTCAAGATGGAAGGCTCGATTTTATTGAACAAAATAGCTTTGGACAGCCTGTATTCGCTATTATTAATAAAGATAAAGTTATTCCGACTAATATTATTAATCGATTAACAGGTGTAATTGATTTAAATAAAAAGAATACAGACCGGATTCAGCCGGCTGTTCCCAGACTGACCGATAATATCTGACCATAAAGCCGTTTCTAGGCTGCATCCACTTCCCGCTGAAACGCCAGCTC