Homologs in group_2457

Help

6 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_16915 EHELCC_16915 100.0 Morganella morganii S2 rhtB Threonine/homoserine/homoserine lactone efflux protein
NLDBIP_17535 NLDBIP_17535 100.0 Morganella morganii S4 rhtB Threonine/homoserine/homoserine lactone efflux protein
LHKJJB_17455 LHKJJB_17455 100.0 Morganella morganii S3 rhtB Threonine/homoserine/homoserine lactone efflux protein
HKOGLL_17270 HKOGLL_17270 100.0 Morganella morganii S5 rhtB Threonine/homoserine/homoserine lactone efflux protein
F4V73_RS10420 F4V73_RS10420 87.7 Morganella psychrotolerans - LysE family transporter
F4V73_RS13380 F4V73_RS13380 37.1 Morganella psychrotolerans - LysE family translocator

Distribution of the homologs in the orthogroup group_2457

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2457

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AG38 2.87e-24 98 31 4 199 1 rhtC Threonine efflux protein Escherichia coli (strain K12)
P0AG39 2.87e-24 98 31 4 199 3 rhtC Threonine efflux protein Escherichia coli O157:H7
Q9L6N7 2.63e-23 95 30 2 197 3 rhtC Threonine efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z3B3 2.72e-23 95 30 2 197 3 rhtC Threonine efflux protein Salmonella typhi
Q1RAZ2 3.32e-19 85 30 5 199 3 leuE Leucine efflux protein Escherichia coli (strain UTI89 / UPEC)
Q8FGV4 3.32e-19 85 30 5 199 3 leuE Leucine efflux protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TH31 3.32e-19 85 30 5 199 3 leuE Leucine efflux protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABX2 3.32e-19 85 30 5 199 3 leuE Leucine efflux protein Escherichia coli O1:K1 / APEC
P76249 4e-19 84 30 5 199 1 leuE Leucine efflux protein Escherichia coli (strain K12)
A8A0Z3 4e-19 84 30 5 199 3 leuE Leucine efflux protein Escherichia coli O9:H4 (strain HS)
Q32FT6 4.49e-19 84 30 5 199 3 leuE Leucine efflux protein Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z2D8 9.34e-19 84 30 5 199 3 leuE Leucine efflux protein Shigella sonnei (strain Ss046)
A7ZMR9 9.34e-19 84 30 5 199 3 leuE Leucine efflux protein Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AHJ0 1.02e-18 84 31 6 199 3 leuE Leucine efflux protein Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8XDS6 3.14e-18 82 30 5 199 3 leuE Leucine efflux protein Escherichia coli O157:H7
P75693 5.45e-18 82 27 2 199 3 yahN Uncharacterized membrane protein YahN Escherichia coli (strain K12)
A6T7N0 1.39e-17 80 30 5 195 3 leuE Leucine efflux protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4WB82 7.93e-17 78 34 1 136 3 leuE Leucine efflux protein Enterobacter sp. (strain 638)
Q321T8 3.74e-16 76 29 5 194 5 leuE Putative leucine efflux protein Shigella boydii serotype 4 (strain Sb227)
Q7CQP8 7.04e-16 76 31 2 141 3 leuE Leucine efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEV9 7.04e-16 76 31 2 141 3 leuE Leucine efflux protein Salmonella typhi
Q5PHF4 7.04e-16 76 31 2 141 3 leuE Leucine efflux protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57Q25 7.04e-16 76 31 2 141 3 leuE Leucine efflux protein Salmonella choleraesuis (strain SC-B67)
Q57320 3.37e-15 74 26 2 200 3 HI_1307 Uncharacterized membrane protein HI_1307 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9L6N6 4.95e-15 73 33 1 128 3 rhtB Homoserine/homoserine lactone efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AG37 8.91e-15 73 31 1 137 3 rhtB Homoserine/homoserine lactone efflux protein Shigella flexneri
P0AG34 8.91e-15 73 31 1 137 1 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli (strain K12)
P0AG35 8.91e-15 73 31 1 137 3 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AG36 8.91e-15 73 31 1 137 3 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli O157:H7
Q8Z3B4 1.65e-14 72 33 1 128 3 rhtB Homoserine/homoserine lactone efflux protein Salmonella typhi
O05406 4.42e-14 71 24 3 190 3 yrhP Uncharacterized membrane protein YrhP Bacillus subtilis (strain 168)
P38102 9.47e-14 70 34 3 134 3 PA4757 Uncharacterized membrane protein PA4757 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KVK7 1.26e-10 62 29 2 140 3 VC_0136 Uncharacterized membrane protein VC_0136 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P74343 0.000101 45 29 1 108 3 slr1627 Uncharacterized membrane protein slr1627 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8Z4J7 0.000117 45 25 3 130 3 eamB Cysteine/O-acetylserine efflux protein Salmonella typhi
Q5PNB4 0.000117 45 25 3 130 3 eamB Cysteine/O-acetylserine efflux protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZMX5 0.000127 44 26 4 130 3 eamB Cysteine/O-acetylserine efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57L56 0.000127 44 26 4 130 3 eamB Cysteine/O-acetylserine efflux protein Salmonella choleraesuis (strain SC-B67)
A6T515 0.000157 44 25 3 143 3 eamB Cysteine/O-acetylserine efflux protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
O87005 0.000329 43 26 6 186 3 chpE Chemotactic transduction protein ChpE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_19625
Feature type CDS
Gene rhtB
Product Threonine/homoserine/homoserine lactone efflux protein
Location 9392 - 10027 (strand: -1)
Length 636 (nucleotides) / 211 (amino acids)
In genomic island -

Contig

Accession contig_42
Length 20536 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2457
Orthogroup size 7
N. genomes 6

Actions

Genomic region

Domains

PF01810 LysE type translocator

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1280 Amino acid transport and metabolism (E) E Threonine/homoserine/homoserine lactone efflux protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05835 threonine efflux protein - -

Protein Sequence

MNLFNQSEFLALALVHFFIVVSPGPDFAVTLRQSIYHGRKAGLMTALGIGAGISVHVVYTLAGVTTLMQATPWLMDTAKYIGAAYLIWLGIQFLRSKGASAAIAPESPDSAPAQTAGKAFWMGFLTNATNPKAMLFFLAMFTTLVSPSTPVTVKLFYGVWMCGVNAAWFMAVSVLFSHQRIRERFLAHSRLFDNVIGTILLLFAGRLLLAV

Flanking regions ( +/- flanking 50bp)

TCTCTCTGCGGCGGCACTCCCGCCGCCCCTGTTAATCTGCTGAGGTTATGATGAATCTGTTCAACCAGAGTGAATTTCTGGCGCTTGCGCTCGTCCATTTTTTCATTGTTGTCTCGCCGGGGCCGGACTTTGCCGTGACGCTGCGCCAGAGTATTTATCACGGACGCAAAGCCGGACTGATGACCGCACTCGGCATTGGCGCCGGGATTTCCGTGCATGTGGTGTACACGCTGGCTGGTGTGACAACCCTGATGCAGGCCACACCGTGGCTGATGGATACCGCGAAATACATTGGTGCGGCTTATCTTATCTGGCTGGGCATTCAGTTTCTGCGCAGTAAAGGCGCAAGTGCCGCTATCGCCCCGGAGAGCCCGGATAGCGCCCCGGCACAAACAGCCGGAAAGGCATTTTGGATGGGATTTCTGACCAACGCCACCAACCCGAAAGCAATGCTGTTTTTCCTGGCCATGTTCACCACGCTGGTCAGTCCGTCCACGCCGGTGACGGTGAAACTGTTCTACGGCGTGTGGATGTGCGGCGTAAATGCGGCCTGGTTTATGGCCGTTTCCGTTTTGTTCTCACACCAGCGTATCCGTGAGCGGTTCCTCGCGCACAGCCGGTTGTTCGACAATGTCATCGGCACTATTCTGCTGCTGTTTGCCGGGCGGCTTTTGCTGGCTGTATAACGGCAAGGTAACCGCCGGTATTATCAGACAGACTCCGAAATTACAGGCAG