Homologs in group_3556

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_01835 EHELCC_01835 100.0 Morganella morganii S2 alpA AlpA family phage regulatory protein
NLDBIP_01625 NLDBIP_01625 100.0 Morganella morganii S4 alpA AlpA family phage regulatory protein
LHKJJB_00410 LHKJJB_00410 100.0 Morganella morganii S3 alpA AlpA family phage regulatory protein
HKOGLL_00450 HKOGLL_00450 100.0 Morganella morganii S5 alpA AlpA family phage regulatory protein

Distribution of the homologs in the orthogroup group_3556

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3556

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P12552 1.01e-09 53 39 0 56 4 None Uncharacterized protein ORF88 Enterobacteria phage P4
P33997 0.000419 38 30 1 62 4 alpA DNA-binding transcriptional activator AlpA Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_18550
Feature type CDS
Gene alpA
Product AlpA family phage regulatory protein
Location 31044 - 31334 (strand: 1)
Length 291 (nucleotides) / 96 (amino acids)
In genomic island -

Contig

Accession contig_34
Length 32354 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3556
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF05930 Prophage CP4-57 regulatory protein (AlpA)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3311 Transcription (K)
Mobilome: prophages, transposons (X)
KX DNA-binding transcriptional regulator AlpA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07733 prophage regulatory protein - -

Protein Sequence

MTTCREYKGILMDPNDRLINFKMVAYLTGLSRSTIWKLENNGDFPERVTLSKRSIRWIESEVMQWVSVRMRMPIKQDDTIHKVRAKKAAKHEQRAL

Flanking regions ( +/- flanking 50bp)

TAAAGGATAACCACCAACACAAGGACGTGTGCCGATGTAAGGAAAATATGATGACAACGTGCAGAGAGTATAAGGGGATTTTGATGGATCCAAACGATAGGTTGATCAACTTCAAGATGGTGGCCTATTTAACGGGACTGTCTCGCTCAACGATTTGGAAATTAGAAAACAATGGTGATTTCCCTGAGCGAGTTACTTTATCAAAACGGTCAATTCGTTGGATTGAAAGTGAAGTTATGCAGTGGGTTAGCGTCCGTATGAGAATGCCCATTAAGCAAGATGACACCATTCACAAGGTACGAGCAAAAAAGGCGGCAAAGCATGAACAGCGCGCGCTTTGATATCGCTGACGCGATTCTGTCACTGCACGGGATCGCACTCTGGTGCGCCA