Homologs in group_2287

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_18050 EHELCC_18050 100.0 Morganella morganii S2 rplJ 50S ribosomal protein L10
NLDBIP_18100 NLDBIP_18100 100.0 Morganella morganii S4 rplJ 50S ribosomal protein L10
LHKJJB_18295 LHKJJB_18295 100.0 Morganella morganii S3 rplJ 50S ribosomal protein L10
HKOGLL_17905 HKOGLL_17905 100.0 Morganella morganii S5 rplJ 50S ribosomal protein L10
F4V73_RS14950 F4V73_RS14950 96.4 Morganella psychrotolerans rplJ 50S ribosomal protein L10
PMI_RS13765 PMI_RS13765 92.1 Proteus mirabilis HI4320 rplJ 50S ribosomal protein L10

Distribution of the homologs in the orthogroup group_2287

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2287

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EYV1 6.35e-105 300 92 0 165 3 rplJ Large ribosomal subunit protein uL10 Proteus mirabilis (strain HI4320)
A8G8E5 4.8e-100 288 88 0 165 3 rplJ Large ribosomal subunit protein uL10 Serratia proteamaculans (strain 568)
Q3YUZ9 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Shigella sonnei (strain Ss046)
P0A7J6 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Shigella flexneri
Q0SY15 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Shigella flexneri serotype 5b (strain 8401)
Q32AF7 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Shigella dysenteriae serotype 1 (strain Sd197)
Q31U12 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Shigella boydii serotype 4 (strain Sb227)
B2TWH1 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LUL7 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R5V0 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli (strain UTI89 / UPEC)
B1LNT7 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli (strain SMS-3-5 / SECEC)
B6I5J5 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli (strain SE11)
B7NFS5 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7J3 8.77e-100 287 89 0 165 1 rplJ Large ribosomal subunit protein uL10 Escherichia coli (strain K12)
B1IUR2 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7J4 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TA80 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AIF7 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O1:K1 / APEC
A8A784 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O9:H4 (strain HS)
B1XBY7 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli (strain K12 / DH10B)
C5A0S5 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M732 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O8 (strain IAI1)
B7MR71 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O81 (strain ED1a)
B7NRR3 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z081 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7J5 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O157:H7
B7LA78 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli (strain 55989 / EAEC)
B7MIX1 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPE0 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUJ8 8.77e-100 287 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O139:H28 (strain E24377A / ETEC)
P0A297 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A298 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella typhi
B4TQJ3 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella schwarzengrund (strain CVM19633)
B5BJQ1 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella paratyphi A (strain AKU_12601)
C0Q2R5 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella paratyphi C (strain RKS4594)
A9N0J1 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK95 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0Y7 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella newport (strain SL254)
B4TCS2 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella heidelberg (strain SL476)
B5RFK3 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QYD6 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella enteritidis PT4 (strain P125109)
B5FQJ7 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella dublin (strain CT_02021853)
Q57H71 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella choleraesuis (strain SC-B67)
A9MHF4 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F0W5 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella agona (strain SL483)
A6TGN8 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XYF7 1.32e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Klebsiella pneumoniae (strain 342)
A8AKU1 2.49e-99 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7N9A6 2.94e-99 286 88 0 163 3 rplJ Large ribosomal subunit protein uL10 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A7MQP7 3.61e-99 285 88 0 165 3 rplJ Large ribosomal subunit protein uL10 Cronobacter sakazakii (strain ATCC BAA-894)
A4W5A5 6.9e-99 285 88 0 165 3 rplJ Large ribosomal subunit protein uL10 Enterobacter sp. (strain 638)
Q2NWR8 3.94e-98 283 87 0 165 3 rplJ Large ribosomal subunit protein uL10 Sodalis glossinidius (strain morsitans)
B2VG94 7.98e-98 282 87 0 164 3 rplJ Large ribosomal subunit protein uL10 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6DHR3 8.41e-98 282 87 0 165 3 rplJ Large ribosomal subunit protein uL10 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5BHE2 1.85e-97 281 87 0 165 3 rplJ Large ribosomal subunit protein uL10 Edwardsiella ictaluri (strain 93-146)
Q6DAN2 3.28e-97 280 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JIH8 1.9e-94 273 86 0 164 3 rplJ Large ribosomal subunit protein uL10 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JJJ6 2.69e-94 273 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FQ4 2.69e-94 273 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TS31 2.69e-94 273 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pestis (strain Pestoides F)
Q1CN80 2.69e-94 273 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0H6 2.69e-94 273 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAP3 2.69e-94 273 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pestis
B2K110 2.69e-94 273 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C1T9 2.69e-94 273 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNI5 2.69e-94 273 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A0KQA7 1.78e-93 271 82 0 165 3 rplJ Large ribosomal subunit protein uL10 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SHU7 3.59e-92 268 82 0 165 3 rplJ Large ribosomal subunit protein uL10 Aeromonas salmonicida (strain A449)
A5UHD1 8.98e-91 264 81 2 166 3 rplJ Large ribosomal subunit protein uL10 Haemophilus influenzae (strain PittGG)
C4LBV4 1.82e-90 263 81 0 164 3 rplJ Large ribosomal subunit protein uL10 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A6VKC7 2.49e-90 263 81 2 166 3 rplJ Large ribosomal subunit protein uL10 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A5UE96 2.93e-90 263 81 2 166 3 rplJ Large ribosomal subunit protein uL10 Haemophilus influenzae (strain PittEE)
B8F6N1 8.04e-90 261 81 2 166 3 rplJ Large ribosomal subunit protein uL10 Glaesserella parasuis serovar 5 (strain SH0165)
B3GYU6 1.39e-89 261 81 2 166 3 rplJ Large ribosomal subunit protein uL10 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N318 1.39e-89 261 81 2 166 3 rplJ Large ribosomal subunit protein uL10 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q4QMS7 1.7e-89 261 80 2 166 3 rplJ Large ribosomal subunit protein uL10 Haemophilus influenzae (strain 86-028NP)
P44350 2.38e-89 260 80 2 166 1 rplJ Large ribosomal subunit protein uL10 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C4K4F3 5.99e-89 259 80 0 164 3 rplJ Large ribosomal subunit protein uL10 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q9CK89 7.29e-89 259 80 2 166 3 rplJ Large ribosomal subunit protein uL10 Pasteurella multocida (strain Pm70)
Q65W44 1.29e-88 258 80 2 166 3 rplJ Large ribosomal subunit protein uL10 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q0I0V0 1.64e-88 258 80 2 166 3 rplJ Large ribosomal subunit protein uL10 Histophilus somni (strain 129Pt)
B0UUZ6 2.02e-88 258 80 2 166 3 rplJ Large ribosomal subunit protein uL10 Histophilus somni (strain 2336)
A3Q973 2.39e-88 258 78 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A8GYW7 2.66e-88 258 79 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A8G1F7 3.83e-88 258 80 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella sediminis (strain HAW-EB3)
B0TM21 4.81e-88 257 79 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella halifaxensis (strain HAW-EB4)
B8CNC3 1.68e-87 256 79 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q7VKL4 6.67e-87 254 78 2 166 3 rplJ Large ribosomal subunit protein uL10 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B1KMZ2 1e-85 251 77 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella woodyi (strain ATCC 51908 / MS32)
Q089R3 2.28e-85 250 77 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella frigidimarina (strain NCIMB 400)
C3LR58 2.93e-85 250 79 1 165 3 rplJ Large ribosomal subunit protein uL10 Vibrio cholerae serotype O1 (strain M66-2)
Q9KV32 2.93e-85 250 79 1 165 3 rplJ Large ribosomal subunit protein uL10 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3P3 2.93e-85 250 79 1 165 3 rplJ Large ribosomal subunit protein uL10 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q0I0B4 1.04e-84 249 76 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella sp. (strain MR-7)
Q0HNU6 1.04e-84 249 76 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella sp. (strain MR-4)
A0KRL5 1.04e-84 249 76 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella sp. (strain ANA-3)
Q8EK76 1.04e-84 249 76 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B6ENR5 2.8e-84 248 77 1 165 3 rplJ Large ribosomal subunit protein uL10 Aliivibrio salmonicida (strain LFI1238)
Q7MGR6 8.75e-84 246 76 1 165 3 rplJ Large ribosomal subunit protein uL10 Vibrio vulnificus (strain YJ016)
Q8DD22 8.75e-84 246 76 1 165 3 rplJ Large ribosomal subunit protein uL10 Vibrio vulnificus (strain CMCP6)
A1S209 1.39e-83 246 76 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A1REA5 2.8e-83 245 76 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella sp. (strain W3-18-1)
A4YBZ2 2.8e-83 245 76 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KW93 2.8e-83 245 76 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella baltica (strain OS195)
A6WHR9 2.8e-83 245 76 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella baltica (strain OS185)
B8EBL4 2.8e-83 245 76 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella baltica (strain OS223)
Q87KQ2 5.83e-83 244 76 1 165 3 rplJ Large ribosomal subunit protein uL10 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q12SW8 1.37e-82 243 75 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q6LLW0 4.95e-82 242 75 1 165 3 rplJ Large ribosomal subunit protein uL10 Photobacterium profundum (strain SS9)
B5FC90 2.76e-81 240 76 1 165 3 rplJ Large ribosomal subunit protein uL10 Aliivibrio fischeri (strain MJ11)
A6W3A1 2.89e-80 238 76 1 163 3 rplJ Large ribosomal subunit protein uL10 Marinomonas sp. (strain MWYL1)
A1T067 4.38e-80 237 73 0 163 3 rplJ Large ribosomal subunit protein uL10 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q1R0I4 5.8e-78 232 72 0 163 3 rplJ Large ribosomal subunit protein uL10 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q4K524 1.79e-77 230 72 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3K5X9 2.18e-77 230 72 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas fluorescens (strain Pf0-1)
Q9HWC7 2.38e-77 230 70 1 165 1 rplJ Large ribosomal subunit protein uL10 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T89 2.38e-77 230 70 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V635 2.38e-77 230 70 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas aeruginosa (strain LESB58)
A6UZH9 2.38e-77 230 70 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas aeruginosa (strain PA7)
B1JDX3 4.31e-77 229 73 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas putida (strain W619)
C1DKK3 1e-76 229 71 1 165 3 rplJ Large ribosomal subunit protein uL10 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q88QP3 2.51e-76 228 73 1 164 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK58 2.51e-76 228 73 1 164 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas putida (strain GB-1)
Q1IFX5 5.71e-76 227 72 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas entomophila (strain L48)
A4XZ99 1.08e-75 226 70 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas mendocina (strain ymp)
A4VHM1 6.64e-75 224 70 1 165 3 rplJ Large ribosomal subunit protein uL10 Stutzerimonas stutzeri (strain A1501)
C3K2Y5 7.75e-75 224 70 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas fluorescens (strain SBW25)
Q889Y0 2.34e-74 223 70 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q47UV7 3.75e-74 222 68 1 163 3 rplJ Large ribosomal subunit protein uL10 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q4ZMN5 7.9e-74 221 70 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas syringae pv. syringae (strain B728a)
Q48D27 7.9e-74 221 70 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3ILQ2 6.39e-73 219 68 1 163 3 rplJ Large ribosomal subunit protein uL10 Pseudoalteromonas translucida (strain TAC 125)
Q1LSX9 7.71e-70 211 64 0 162 3 rplJ Large ribosomal subunit protein uL10 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q2S903 6.43e-58 181 56 2 176 3 rplJ Large ribosomal subunit protein uL10 Hahella chejuensis (strain KCTC 2396)
Q0VSM4 3.04e-56 177 55 1 175 3 rplJ Large ribosomal subunit protein uL10 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q21M95 1.47e-55 175 55 2 176 3 rplJ Large ribosomal subunit protein uL10 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B8D6V2 2.66e-55 174 49 0 165 3 rplJ Large ribosomal subunit protein uL10 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57148 2.66e-55 174 49 0 165 3 rplJ Large ribosomal subunit protein uL10 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8J8 2.66e-55 174 49 0 165 3 rplJ Large ribosomal subunit protein uL10 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
C5BQ37 3.6e-53 169 52 2 176 3 rplJ Large ribosomal subunit protein uL10 Teredinibacter turnerae (strain ATCC 39867 / T7901)
A1WVD1 2.05e-51 165 50 1 175 3 rplJ Large ribosomal subunit protein uL10 Halorhodospira halophila (strain DSM 244 / SL1)
A1TYI8 6.43e-51 164 53 2 176 3 rplJ Large ribosomal subunit protein uL10 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q0BKC2 1.13e-50 163 53 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A1M5 1.13e-50 163 53 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella tularensis subsp. holarctica (strain LVS)
A7NEC2 1.13e-50 163 53 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A4IW97 1.71e-50 162 53 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NID4 1.71e-50 162 53 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q869 1.71e-50 162 53 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella tularensis subsp. novicida (strain U112)
Q14JT7 1.71e-50 162 53 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella tularensis subsp. tularensis (strain FSC 198)
B0TX08 1.97e-50 162 53 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B2SFD4 4.42e-50 161 53 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q8KA68 7.98e-50 160 49 0 165 3 rplJ Large ribosomal subunit protein uL10 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89B18 1.42e-49 160 44 1 168 3 rplJ Large ribosomal subunit protein uL10 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A5IHS3 3.08e-48 157 50 1 172 3 rplJ Large ribosomal subunit protein uL10 Legionella pneumophila (strain Corby)
Q8D235 3.96e-48 156 41 0 160 3 rplJ Large ribosomal subunit protein uL10 Wigglesworthia glossinidia brevipalpis
B0VDG4 4.7e-48 156 49 2 166 3 rplJ Large ribosomal subunit protein uL10 Acinetobacter baumannii (strain AYE)
A3M1G1 4.7e-48 156 49 2 166 3 rplJ Large ribosomal subunit protein uL10 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VLZ8 4.7e-48 156 49 2 166 3 rplJ Large ribosomal subunit protein uL10 Acinetobacter baumannii (strain SDF)
B2I1Y9 4.7e-48 156 49 2 166 3 rplJ Large ribosomal subunit protein uL10 Acinetobacter baumannii (strain ACICU)
B7I358 4.7e-48 156 49 2 166 3 rplJ Large ribosomal subunit protein uL10 Acinetobacter baumannii (strain AB0057)
B7H1K0 4.7e-48 156 49 2 166 3 rplJ Large ribosomal subunit protein uL10 Acinetobacter baumannii (strain AB307-0294)
Q5WZM1 6.25e-48 156 50 1 172 3 rplJ Large ribosomal subunit protein uL10 Legionella pneumophila (strain Lens)
Q5ZYQ2 6.25e-48 156 50 1 172 3 rplJ Large ribosomal subunit protein uL10 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X868 6.25e-48 156 50 1 172 3 rplJ Large ribosomal subunit protein uL10 Legionella pneumophila (strain Paris)
Q0ABI4 2.32e-47 154 48 1 175 3 rplJ Large ribosomal subunit protein uL10 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q6FF92 2.6e-47 154 50 2 166 3 rplJ Large ribosomal subunit protein uL10 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q492B7 1.92e-46 152 44 0 163 3 rplJ Large ribosomal subunit protein uL10 Blochmanniella pennsylvanica (strain BPEN)
A5WH37 1.95e-46 152 52 1 175 3 rplJ Large ribosomal subunit protein uL10 Psychrobacter sp. (strain PRwf-1)
Q83ET2 6.06e-46 151 48 2 175 3 rplJ Large ribosomal subunit protein uL10 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAL2 6.06e-46 151 48 2 175 3 rplJ Large ribosomal subunit protein uL10 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD41 6.06e-46 151 48 2 175 3 rplJ Large ribosomal subunit protein uL10 Coxiella burnetii (strain Dugway 5J108-111)
B6J273 6.06e-46 151 48 2 175 3 rplJ Large ribosomal subunit protein uL10 Coxiella burnetii (strain CbuG_Q212)
B6J5C0 6.06e-46 151 48 2 175 3 rplJ Large ribosomal subunit protein uL10 Coxiella burnetii (strain CbuK_Q154)
P41192 1.85e-45 147 87 0 86 3 rplJ Large ribosomal subunit protein uL10 (Fragment) Serratia marcescens
Q31IZ1 3.14e-45 149 48 1 164 3 rplJ Large ribosomal subunit protein uL10 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q5QWA7 3.81e-43 144 44 1 172 3 rplJ Large ribosomal subunit protein uL10 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B8GV67 8.25e-43 143 49 1 175 3 rplJ Large ribosomal subunit protein uL10 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q4FQH1 1.2e-41 140 48 1 175 3 rplJ Large ribosomal subunit protein uL10 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1H4P6 2.29e-41 139 46 3 176 3 rplJ Large ribosomal subunit protein uL10 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q60A08 3.24e-41 139 50 1 175 3 rplJ Large ribosomal subunit protein uL10 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8RTJ3 3.79e-41 139 46 1 162 3 rplJ Large ribosomal subunit protein uL10 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU91 3.79e-41 139 46 1 162 3 rplJ Large ribosomal subunit protein uL10 Xanthomonas campestris pv. campestris (strain B100)
Q4URD0 3.79e-41 139 46 1 162 3 rplJ Large ribosomal subunit protein uL10 Xanthomonas campestris pv. campestris (strain 8004)
A5EX72 6.05e-41 138 47 2 168 3 rplJ Large ribosomal subunit protein uL10 Dichelobacter nodosus (strain VCS1703A)
Q5GWS4 1.28e-40 137 47 1 162 3 rplJ Large ribosomal subunit protein uL10 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQP9 1.28e-40 137 47 1 162 3 rplJ Large ribosomal subunit protein uL10 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZX6 1.28e-40 137 47 1 162 3 rplJ Large ribosomal subunit protein uL10 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BWZ3 2e-40 137 46 1 162 3 rplJ Large ribosomal subunit protein uL10 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PNT2 2e-40 137 46 1 162 3 rplJ Large ribosomal subunit protein uL10 Xanthomonas axonopodis pv. citri (strain 306)
Q1Q8P7 2.4e-40 137 47 1 175 3 rplJ Large ribosomal subunit protein uL10 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q7VRP5 6.18e-40 135 40 0 161 3 rplJ Large ribosomal subunit protein uL10 Blochmanniella floridana
Q15YB3 4.66e-39 133 49 1 155 3 rplJ Large ribosomal subunit protein uL10 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B2FQ36 5.26e-38 131 49 0 145 3 rplJ Large ribosomal subunit protein uL10 Stenotrophomonas maltophilia (strain K279a)
B4SKV4 7.95e-38 130 48 0 145 3 rplJ Large ribosomal subunit protein uL10 Stenotrophomonas maltophilia (strain R551-3)
A1AX77 1.09e-37 130 45 1 155 3 rplJ Large ribosomal subunit protein uL10 Ruthia magnifica subsp. Calyptogena magnifica
Q7NQE4 7.53e-37 127 44 3 166 3 rplJ Large ribosomal subunit protein uL10 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q3J8Q5 1.21e-35 125 44 2 175 3 rplJ Large ribosomal subunit protein uL10 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q47JB2 1.25e-35 124 43 2 165 3 rplJ Large ribosomal subunit protein uL10 Dechloromonas aromatica (strain RCB)
A5CW27 9.36e-35 122 42 1 155 3 rplJ Large ribosomal subunit protein uL10 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q2YB07 3.12e-34 121 40 2 175 3 rplJ Large ribosomal subunit protein uL10 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B1HMZ9 3.6e-34 120 42 1 163 3 rplJ Large ribosomal subunit protein uL10 Lysinibacillus sphaericus (strain C3-41)
Q5P341 5.1e-34 120 42 2 163 3 rplJ Large ribosomal subunit protein uL10 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A9IJ29 1.57e-33 119 41 3 176 3 rplJ Large ribosomal subunit protein uL10 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q7W0S1 1.99e-33 119 41 3 176 3 rplJ Large ribosomal subunit protein uL10 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2H1 1.99e-33 119 41 3 176 3 rplJ Large ribosomal subunit protein uL10 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRE1 1.99e-33 119 41 3 176 3 rplJ Large ribosomal subunit protein uL10 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B0U5X9 2.14e-33 119 44 0 145 3 rplJ Large ribosomal subunit protein uL10 Xylella fastidiosa (strain M12)
Q8XUZ6 5.26e-33 118 40 2 164 3 rplJ Large ribosomal subunit protein uL10 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q87A30 5.61e-33 118 42 1 162 3 rplJ Large ribosomal subunit protein uL10 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2IA70 5.61e-33 118 42 1 162 3 rplJ Large ribosomal subunit protein uL10 Xylella fastidiosa (strain M23)
Q82T73 9.52e-33 117 41 2 172 3 rplJ Large ribosomal subunit protein uL10 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
C1DAQ8 1.03e-32 117 40 2 162 3 rplJ Large ribosomal subunit protein uL10 Laribacter hongkongensis (strain HLHK9)
Q058E3 1.1e-32 117 36 0 158 3 rplJ Large ribosomal subunit protein uL10 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q9PA84 1.39e-32 117 44 0 145 3 rplJ Large ribosomal subunit protein uL10 Xylella fastidiosa (strain 9a5c)
Q03E50 3.54e-32 115 46 0 132 3 rplJ Large ribosomal subunit protein uL10 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q03ST7 8.81e-32 114 44 0 133 3 rplJ Large ribosomal subunit protein uL10 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q1BRT8 1.06e-31 114 40 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia orbicola (strain AU 1054)
B1JU12 1.06e-31 114 40 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia orbicola (strain MC0-3)
A0K3L5 1.06e-31 114 40 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia cenocepacia (strain HI2424)
B2G5T6 1.56e-31 114 38 1 158 3 rplJ Large ribosomal subunit protein uL10 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VIA9 1.56e-31 114 38 1 158 3 rplJ Large ribosomal subunit protein uL10 Limosilactobacillus reuteri (strain DSM 20016)
Q3A6Q6 1.74e-31 114 35 1 167 3 rplJ Large ribosomal subunit protein uL10 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B4E5B0 1.91e-31 114 40 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q0AF51 2e-31 114 42 2 155 3 rplJ Large ribosomal subunit protein uL10 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q39KH7 4.34e-31 113 40 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B1XSP1 6.36e-31 113 40 1 143 3 rplJ Large ribosomal subunit protein uL10 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q0K604 8.8e-31 112 39 1 149 3 rplJ Large ribosomal subunit protein uL10 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B2JIH6 1.08e-30 112 40 2 163 3 rplJ Large ribosomal subunit protein uL10 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B2UEN8 1.11e-30 112 40 2 158 3 rplJ Large ribosomal subunit protein uL10 Ralstonia pickettii (strain 12J)
A1KB36 1.2e-30 112 40 1 144 3 rplJ Large ribosomal subunit protein uL10 Azoarcus sp. (strain BH72)
A8F972 1.28e-30 112 38 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus pumilus (strain SAFR-032)
C5D3Q6 1.29e-30 112 42 0 144 3 rplJ Large ribosomal subunit protein uL10 Geobacillus sp. (strain WCH70)
Q5L419 2.37e-30 111 40 0 144 3 rplJ Large ribosomal subunit protein uL10 Geobacillus kaustophilus (strain HTA426)
B3R7T8 2.68e-30 111 40 1 149 3 rplJ Large ribosomal subunit protein uL10 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
B5XLE2 2.88e-30 110 41 1 151 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DD99 2.88e-30 110 41 1 151 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TS4 2.88e-30 110 41 1 151 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2REM5 2.88e-30 110 41 1 151 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q5XCB5 2.88e-30 110 41 1 151 1 rplJ Large ribosomal subunit protein uL10 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DD98 2.88e-30 110 41 1 151 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
A9VNB2 3.2e-30 110 38 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus mycoides (strain KBAB4)
P68900 4.02e-30 110 40 1 151 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pyogenes serotype M1
B4U3I0 4.11e-30 110 43 0 130 3 rplJ Large ribosomal subunit protein uL10 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q46WD2 4.18e-30 110 38 2 162 3 rplJ Large ribosomal subunit protein uL10 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A2SLG7 4.68e-30 110 41 4 163 3 rplJ Large ribosomal subunit protein uL10 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q1WST4 5.47e-30 110 43 0 137 3 rplJ Large ribosomal subunit protein uL10 Ligilactobacillus salivarius (strain UCC118)
Q8P159 8.86e-30 109 40 1 151 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q81J51 1.05e-29 109 38 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q38V10 1.11e-29 109 43 0 137 3 rplJ Large ribosomal subunit protein uL10 Latilactobacillus sakei subsp. sakei (strain 23K)
Q6HPR9 1.19e-29 109 38 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63HA1 1.19e-29 109 38 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain ZK / E33L)
B9IZI3 1.19e-29 109 38 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain Q1)
B7HQT3 1.19e-29 109 38 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain AH187)
B7HJ37 1.19e-29 109 38 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain B4264)
C1ET28 1.19e-29 109 38 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain 03BB102)
Q73FA7 1.19e-29 109 38 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JKA7 1.19e-29 109 38 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain AH820)
Q81VU1 1.19e-29 109 38 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus anthracis
C3LJ71 1.19e-29 109 38 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9P4 1.19e-29 109 38 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus anthracis (strain A0248)
Q8ETZ1 1.37e-29 109 37 1 159 3 rplJ Large ribosomal subunit protein uL10 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q39Y15 1.42e-29 109 39 2 172 3 rplJ Large ribosomal subunit protein uL10 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A4IJH8 1.52e-29 108 38 0 144 3 rplJ Large ribosomal subunit protein uL10 Geobacillus thermodenitrificans (strain NG80-2)
A5GAX9 1.6e-29 109 38 3 173 3 rplJ Large ribosomal subunit protein uL10 Geotalea uraniireducens (strain Rf4)
Q1LI18 1.7e-29 109 39 1 149 3 rplJ Large ribosomal subunit protein uL10 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q88YW8 1.76e-29 108 42 0 128 3 rplJ Large ribosomal subunit protein uL10 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q748Y4 1.97e-29 108 38 2 172 3 rplJ Large ribosomal subunit protein uL10 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q6GBU8 2.91e-29 108 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain MSSA476)
Q03LT2 3.06e-29 108 42 0 133 3 rplJ Large ribosomal subunit protein uL10 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M5F2 3.06e-29 108 42 0 133 3 rplJ Large ribosomal subunit protein uL10 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M0W5 3.06e-29 108 42 0 133 3 rplJ Large ribosomal subunit protein uL10 Streptococcus thermophilus (strain CNRZ 1066)
P66049 3.11e-29 108 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain MW2)
A8YZN7 3.11e-29 108 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain USA300 / TCH1516)
Q6GJC9 3.11e-29 108 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain MRSA252)
P99155 3.11e-29 108 36 1 163 1 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain N315)
P66048 3.11e-29 108 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QEJ1 3.11e-29 108 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain Newman)
Q5HID6 3.11e-29 108 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain COL)
Q2YSC2 3.11e-29 108 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IQ93 3.11e-29 108 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain JH9)
Q2G0N9 3.11e-29 108 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJA1 3.11e-29 108 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain USA300)
A6TZ16 3.11e-29 108 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain JH1)
A7WYW2 3.11e-29 108 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain Mu3 / ATCC 700698)
B9M6V4 3.53e-29 108 38 3 173 3 rplJ Large ribosomal subunit protein uL10 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B7IT08 5.82e-29 107 37 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain G9842)
B9DU77 9.67e-29 107 43 0 130 3 rplJ Large ribosomal subunit protein uL10 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B2GAC5 1.19e-28 107 40 1 140 3 rplJ Large ribosomal subunit protein uL10 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
P66042 1.31e-28 106 38 1 164 3 rplJ Large ribosomal subunit protein uL10 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P66043 1.31e-28 106 38 1 164 3 rplJ Large ribosomal subunit protein uL10 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
C6E4R6 1.46e-28 106 37 2 173 3 rplJ Large ribosomal subunit protein uL10 Geobacter sp. (strain M21)
B5EFP1 1.46e-28 106 37 2 173 3 rplJ Large ribosomal subunit protein uL10 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A7Z0M6 1.77e-28 106 37 2 167 3 rplJ Large ribosomal subunit protein uL10 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A0AF49 2.08e-28 106 38 1 164 3 rplJ Large ribosomal subunit protein uL10 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B8DF05 2.08e-28 106 38 1 164 3 rplJ Large ribosomal subunit protein uL10 Listeria monocytogenes serotype 4a (strain HCC23)
Q724G2 2.08e-28 106 38 1 164 3 rplJ Large ribosomal subunit protein uL10 Listeria monocytogenes serotype 4b (strain F2365)
C1KYI2 2.08e-28 106 38 1 164 3 rplJ Large ribosomal subunit protein uL10 Listeria monocytogenes serotype 4b (strain CLIP80459)
A7GK10 2.25e-28 106 37 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A1KRG4 2.48e-28 105 40 2 162 3 rplJ Large ribosomal subunit protein uL10 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66047 2.48e-28 105 40 2 162 3 rplJ Large ribosomal subunit protein uL10 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66046 2.48e-28 105 40 2 162 3 rplJ Large ribosomal subunit protein uL10 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A6TWJ2 2.85e-28 105 35 1 166 3 rplJ Large ribosomal subunit protein uL10 Alkaliphilus metalliredigens (strain QYMF)
Q9KGE4 3.09e-28 105 39 1 159 3 rplJ Large ribosomal subunit protein uL10 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5F5R3 3.73e-28 105 40 2 162 3 rplJ Large ribosomal subunit protein uL10 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A8MLD0 5.36e-28 105 37 2 163 3 rplJ Large ribosomal subunit protein uL10 Alkaliphilus oremlandii (strain OhILAs)
Q8DUH2 7.57e-28 104 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q03ZH4 8.5e-28 105 41 0 133 3 rplJ Large ribosomal subunit protein uL10 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B1MVU2 8.61e-28 104 39 0 133 3 rplJ Large ribosomal subunit protein uL10 Leuconostoc citreum (strain KM20)
B8FEU3 1.16e-27 104 36 1 170 3 rplJ Large ribosomal subunit protein uL10 Desulfatibacillum aliphaticivorans
Q8DZ20 1.42e-27 103 40 0 130 3 rplJ Large ribosomal subunit protein uL10 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q65PB8 1.77e-27 103 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B9E8Q8 2.41e-27 103 37 1 143 3 rplJ Large ribosomal subunit protein uL10 Macrococcus caseolyticus (strain JCSC5402)
Q035V5 2.55e-27 103 37 1 160 3 rplJ Large ribosomal subunit protein uL10 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WA02 2.55e-27 103 37 1 160 3 rplJ Large ribosomal subunit protein uL10 Lacticaseibacillus casei (strain BL23)
Q8E4M6 2.64e-27 103 40 0 130 3 rplJ Large ribosomal subunit protein uL10 Streptococcus agalactiae serotype III (strain NEM316)
Q3K0K8 2.64e-27 103 40 0 130 3 rplJ Large ribosomal subunit protein uL10 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
A1ALT2 2.68e-27 103 37 3 172 3 rplJ Large ribosomal subunit protein uL10 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q02YR7 4.68e-27 102 43 0 123 3 rplJ Large ribosomal subunit protein uL10 Lactococcus lactis subsp. cremoris (strain SK11)
A2RKI8 4.68e-27 102 43 0 123 3 rplJ Large ribosomal subunit protein uL10 Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CG41 4.83e-27 102 43 0 123 3 rplJ Large ribosomal subunit protein uL10 Lactococcus lactis subsp. lactis (strain IL1403)
Q8XHR6 6.34e-27 102 37 1 160 3 rplJ Large ribosomal subunit protein uL10 Clostridium perfringens (strain 13 / Type A)
P42923 9.22e-27 102 36 2 167 1 rplJ Large ribosomal subunit protein uL10 Bacillus subtilis (strain 168)
Q21SF5 1.25e-26 102 36 2 165 3 rplJ Large ribosomal subunit protein uL10 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q890N3 1.4e-26 101 37 1 161 3 rplJ Large ribosomal subunit protein uL10 Clostridium tetani (strain Massachusetts / E88)
C5CKF1 1.52e-26 101 37 2 162 3 rplJ Large ribosomal subunit protein uL10 Variovorax paradoxus (strain S110)
A8AXG9 2.03e-26 101 39 1 158 3 rplJ Large ribosomal subunit protein uL10 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A3CMW1 2.28e-26 100 39 1 158 3 rplJ Large ribosomal subunit protein uL10 Streptococcus sanguinis (strain SK36)
Q830Q7 2.33e-26 100 37 0 137 3 rplJ Large ribosomal subunit protein uL10 Enterococcus faecalis (strain ATCC 700802 / V583)
Q2JFI7 3.28e-26 101 38 2 168 3 rplJ Large ribosomal subunit protein uL10 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
B8D0B4 3.97e-26 100 37 1 167 3 rplJ Large ribosomal subunit protein uL10 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q5WLS3 4.91e-26 100 38 1 163 3 rplJ Large ribosomal subunit protein uL10 Shouchella clausii (strain KSM-K16)
Q3SLQ8 5.82e-26 100 40 2 144 3 rplJ Large ribosomal subunit protein uL10 Thiobacillus denitrificans (strain ATCC 25259)
A1VTG0 1.12e-25 99 41 1 139 3 rplJ Large ribosomal subunit protein uL10 Polaromonas naphthalenivorans (strain CJ2)
Q97EG7 1.31e-25 99 36 1 161 3 rplJ Large ribosomal subunit protein uL10 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A4G9U7 1.35e-25 99 39 1 143 3 rplJ Large ribosomal subunit protein uL10 Herminiimonas arsenicoxydans
C1CR00 1.38e-25 99 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CL63 1.38e-25 99 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae (strain P1031)
C1CEU4 1.38e-25 99 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae (strain JJA)
P66051 1.38e-25 99 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P66050 1.38e-25 99 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKK4 1.38e-25 99 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1ICF5 1.38e-25 99 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae (strain Hungary19A-6)
Q04JZ3 1.38e-25 99 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8CTT2 1.44e-25 99 34 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRL3 1.44e-25 99 34 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B9DKX2 1.47e-25 99 34 0 140 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus carnosus (strain TM300)
A6T3L5 1.5e-25 99 38 1 143 3 rplJ Large ribosomal subunit protein uL10 Janthinobacterium sp. (strain Marseille)
Q0RRT3 2.39e-25 99 37 2 166 3 rplJ Large ribosomal subunit protein uL10 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
B5ELX0 2.57e-25 98 37 2 174 3 rplJ Large ribosomal subunit protein uL10 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J457 2.57e-25 98 37 2 174 3 rplJ Large ribosomal subunit protein uL10 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q4L3K0 2.91e-25 98 34 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus haemolyticus (strain JCSC1435)
B5E5F1 3.34e-25 97 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae serotype 19F (strain G54)
Q49V49 5.55e-25 97 36 0 130 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
C1AYX3 6.35e-25 97 40 1 138 3 rplJ Large ribosomal subunit protein uL10 Rhodococcus opacus (strain B4)
Q0SF99 6.35e-25 97 40 1 138 3 rplJ Large ribosomal subunit protein uL10 Rhodococcus jostii (strain RHA1)
Q3A9Q4 6.99e-25 97 33 1 168 3 rplJ Large ribosomal subunit protein uL10 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q92QH9 7.12e-25 97 39 2 169 3 rplJ Large ribosomal subunit protein uL10 Rhizobium meliloti (strain 1021)
C1C7V5 7.91e-25 97 41 0 125 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae (strain 70585)
Q2RFN7 1.02e-24 97 34 1 167 3 rplJ Large ribosomal subunit protein uL10 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q18CE8 1.08e-24 96 36 1 141 3 rplJ Large ribosomal subunit protein uL10 Clostridioides difficile (strain 630)
C0ZV33 1.1e-24 97 38 2 163 3 rplJ Large ribosomal subunit protein uL10 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
B1YRC0 1.17e-24 96 40 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia ambifaria (strain MC40-6)
A9ADI3 2.44e-24 95 40 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia multivorans (strain ATCC 17616 / 249)
Q6AP80 3.57e-24 95 34 2 172 3 rplJ Large ribosomal subunit protein uL10 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q123G1 4.39e-24 95 38 2 147 3 rplJ Large ribosomal subunit protein uL10 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q2SU17 5.59e-24 94 39 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q01 6.86e-24 94 39 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia pseudomallei (strain K96243)
Q3JMQ1 6.86e-24 94 39 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia pseudomallei (strain 1710b)
Q62GJ5 6.86e-24 94 39 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia mallei (strain ATCC 23344)
A2S7G4 6.86e-24 94 39 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia mallei (strain NCTC 10229)
A4FPQ7 7e-24 94 39 1 138 3 rplJ Large ribosomal subunit protein uL10 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A7HCH9 1.03e-23 94 33 1 171 3 rplJ Large ribosomal subunit protein uL10 Anaeromyxobacter sp. (strain Fw109-5)
A1WCN1 1.24e-23 94 39 1 139 3 rplJ Large ribosomal subunit protein uL10 Acidovorax sp. (strain JS42)
B9MH49 1.24e-23 94 39 1 139 3 rplJ Large ribosomal subunit protein uL10 Acidovorax ebreus (strain TPSY)
B9KYX5 1.33e-23 94 36 0 133 3 rplJ Large ribosomal subunit protein uL10 Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
A9BR96 1.81e-23 94 38 1 139 3 rplJ Large ribosomal subunit protein uL10 Delftia acidovorans (strain DSM 14801 / SPH-1)
B3E7S6 3.86e-23 92 35 2 167 3 rplJ Large ribosomal subunit protein uL10 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A1TVT2 4.26e-23 92 38 1 139 3 rplJ Large ribosomal subunit protein uL10 Paracidovorax citrulli (strain AAC00-1)
B8JB72 4.58e-23 92 33 2 175 3 rplJ Large ribosomal subunit protein uL10 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q30X08 5.49e-23 92 36 2 169 3 rplJ Large ribosomal subunit protein uL10 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B4UDT4 6.13e-23 92 33 2 175 3 rplJ Large ribosomal subunit protein uL10 Anaeromyxobacter sp. (strain K)
Q13TG0 7.04e-23 92 37 2 141 3 rplJ Large ribosomal subunit protein uL10 Paraburkholderia xenovorans (strain LB400)
B2T761 7.04e-23 92 37 2 141 3 rplJ Large ribosomal subunit protein uL10 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q98QS1 7.7e-23 92 35 0 140 3 rplJ Large ribosomal subunit protein uL10 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q04E44 1.25e-22 92 37 0 133 3 rplJ Large ribosomal subunit protein uL10 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q2II80 1.26e-22 91 36 1 151 3 rplJ Large ribosomal subunit protein uL10 Anaeromyxobacter dehalogenans (strain 2CP-C)
A1WK53 4.5e-22 90 39 1 139 3 rplJ Large ribosomal subunit protein uL10 Verminephrobacter eiseniae (strain EF01-2)
A9GRA5 5.6e-22 90 35 3 153 3 rplJ Large ribosomal subunit protein uL10 Sorangium cellulosum (strain So ce56)
Q2RQV1 6.8e-22 89 34 2 173 3 rplJ Large ribosomal subunit protein uL10 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A8HTY1 6.87e-22 89 36 2 169 3 rplJ Large ribosomal subunit protein uL10 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B9JVM6 7.33e-22 89 35 2 169 3 rplJ Large ribosomal subunit protein uL10 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q5YPC7 1.2e-21 89 36 2 168 3 rplJ Large ribosomal subunit protein uL10 Nocardia farcinica (strain IFM 10152)
B8DLM5 1.37e-21 89 35 0 142 3 rplJ Large ribosomal subunit protein uL10 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q8UE06 1.53e-21 88 36 2 169 1 rplJ Large ribosomal subunit protein uL10 Agrobacterium fabrum (strain C58 / ATCC 33970)
A6X0A7 2.05e-21 88 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B2A4C8 2.23e-21 88 31 1 170 3 rplJ Large ribosomal subunit protein uL10 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q6AH11 2.83e-21 88 32 2 171 3 rplJ Large ribosomal subunit protein uL10 Leifsonia xyli subsp. xyli (strain CTCB07)
Q67JT1 2.99e-21 88 37 1 140 3 rplJ Large ribosomal subunit protein uL10 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q11HB1 3.73e-21 87 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Chelativorans sp. (strain BNC1)
B3PW57 4.77e-21 87 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Rhizobium etli (strain CIAT 652)
Q8YHP9 5.31e-21 87 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJL3 5.31e-21 87 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5R2 5.31e-21 87 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q2YM13 5.31e-21 87 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella abortus (strain 2308)
B2S689 5.31e-21 87 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella abortus (strain S19)
Q2K9M6 5.98e-21 87 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B5ZYS5 6.11e-21 87 35 2 169 3 rplJ Large ribosomal subunit protein uL10 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1D7U5 6.19e-21 87 37 2 156 3 rplJ Large ribosomal subunit protein uL10 Myxococcus xanthus (strain DK1622)
P41107 6.94e-21 87 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella abortus biovar 1 (strain 9-941)
Q8R7U4 7.01e-21 87 31 3 176 3 rplJ Large ribosomal subunit protein uL10 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q73JJ5 8.53e-21 87 36 2 158 3 rplJ Large ribosomal subunit protein uL10 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q6G3X7 8.79e-21 86 32 2 173 3 rplJ Large ribosomal subunit protein uL10 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A1USC6 8.97e-21 86 32 2 173 3 rplJ Large ribosomal subunit protein uL10 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B9JDR9 1.03e-20 86 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B0KCJ0 1.08e-20 86 35 2 141 3 rplJ Large ribosomal subunit protein uL10 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B0CH43 1.17e-20 86 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella suis (strain ATCC 23445 / NCTC 10510)
A8LC66 1.37e-20 86 35 3 170 3 rplJ Large ribosomal subunit protein uL10 Parafrankia sp. (strain EAN1pec)
A5D5H8 1.49e-20 86 35 2 172 3 rplJ Large ribosomal subunit protein uL10 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q1MPU2 1.58e-20 86 33 0 142 3 rplJ Large ribosomal subunit protein uL10 Lawsonia intracellularis (strain PHE/MN1-00)
Q1MIF1 1.76e-20 85 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B0K5G6 1.8e-20 86 35 2 141 3 rplJ Large ribosomal subunit protein uL10 Thermoanaerobacter sp. (strain X514)
B6IRP4 2.09e-20 85 33 2 168 3 rplJ Large ribosomal subunit protein uL10 Rhodospirillum centenum (strain ATCC 51521 / SW)
B8J1A6 2.26e-20 85 34 0 138 3 rplJ Large ribosomal subunit protein uL10 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
A0LII2 2.3e-20 85 34 0 147 3 rplJ Large ribosomal subunit protein uL10 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
P36257 2.9e-20 85 34 2 167 3 rplJ Large ribosomal subunit protein uL10 Streptomyces griseus
B1W444 2.9e-20 85 34 2 167 3 rplJ Large ribosomal subunit protein uL10 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
P41191 4.32e-20 85 29 2 173 3 rplJ Large ribosomal subunit protein uL10 Liberibacter africanus
Q2LQ89 4.67e-20 85 34 0 136 3 rplJ Large ribosomal subunit protein uL10 Syntrophus aciditrophicus (strain SB)
Q8G067 5.64e-20 84 33 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella suis biovar 1 (strain 1330)
B1MH70 6.06e-20 84 34 2 166 3 rplJ Large ribosomal subunit protein uL10 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
C6C177 6.42e-20 84 34 1 173 3 rplJ Large ribosomal subunit protein uL10 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q727C9 6.78e-20 84 35 0 142 3 rplJ Large ribosomal subunit protein uL10 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q1IHH2 7.32e-20 84 35 1 157 3 rplJ Large ribosomal subunit protein uL10 Koribacter versatilis (strain Ellin345)
Q98N68 1.03e-19 84 36 2 169 3 rplJ Large ribosomal subunit protein uL10 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B1Y7H5 1.06e-19 84 35 2 162 3 rplJ Large ribosomal subunit protein uL10 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q82DQ7 1.14e-19 84 34 2 166 3 rplJ Large ribosomal subunit protein uL10 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A8G2K9 1.56e-19 83 32 1 140 3 rplJ Large ribosomal subunit protein uL10 Prochlorococcus marinus (strain MIT 9215)
B0S064 1.88e-19 83 32 0 140 3 rplJ Large ribosomal subunit protein uL10 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
A9ISF5 1.95e-19 83 32 2 173 3 rplJ Large ribosomal subunit protein uL10 Bartonella tribocorum (strain CIP 105476 / IBS 506)
A7HWQ2 2.03e-19 83 33 2 169 3 rplJ Large ribosomal subunit protein uL10 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A7IKP8 2.62e-19 82 34 2 168 3 rplJ Large ribosomal subunit protein uL10 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q6FZL7 2.71e-19 82 32 2 173 3 rplJ Large ribosomal subunit protein uL10 Bartonella quintana (strain Toulouse)
Q0ANP1 4.37e-19 82 39 2 141 3 rplJ Large ribosomal subunit protein uL10 Maricaulis maris (strain MCS10)
P36249 4.38e-19 82 31 2 159 3 rplJ Large ribosomal subunit protein uL10 Liberibacter asiaticus
Q3Z7T5 4.49e-19 82 32 2 151 3 rplJ Large ribosomal subunit protein uL10 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q73SE9 5.31e-19 82 33 2 168 3 rplJ Large ribosomal subunit protein uL10 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QL54 5.9e-19 82 33 2 168 3 rplJ Large ribosomal subunit protein uL10 Mycobacterium avium (strain 104)
Q2W2H9 1.03e-18 81 35 2 149 3 rplJ Large ribosomal subunit protein uL10 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A4YSH9 1.54e-18 80 34 2 168 3 rplJ Large ribosomal subunit protein uL10 Bradyrhizobium sp. (strain ORS 278)
A5ELN9 1.54e-18 80 34 2 168 3 rplJ Large ribosomal subunit protein uL10 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B3QYL2 1.64e-18 80 29 1 148 3 rplJ Large ribosomal subunit protein uL10 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q3ZXX9 1.7e-18 80 32 1 139 3 rplJ Large ribosomal subunit protein uL10 Dehalococcoides mccartyi (strain CBDB1)
A5FQR0 1.7e-18 80 32 1 139 3 rplJ Large ribosomal subunit protein uL10 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q3ATP7 1.91e-18 80 37 1 132 3 rplJ Large ribosomal subunit protein uL10 Chlorobium chlorochromatii (strain CaD3)
B0UHX8 1.91e-18 80 34 2 163 3 rplJ Large ribosomal subunit protein uL10 Methylobacterium sp. (strain 4-46)
Q9CBK7 2.08e-18 80 32 2 166 3 rplJ Large ribosomal subunit protein uL10 Mycobacterium leprae (strain TN)
B8ZSD0 2.08e-18 80 32 2 166 3 rplJ Large ribosomal subunit protein uL10 Mycobacterium leprae (strain Br4923)
Q31CX9 2.34e-18 80 30 1 140 3 rplJ Large ribosomal subunit protein uL10 Prochlorococcus marinus (strain MIT 9312)
A3PAS0 2.52e-18 80 30 1 140 3 rplJ Large ribosomal subunit protein uL10 Prochlorococcus marinus (strain MIT 9301)
P9WHE7 2.72e-18 80 33 2 166 1 rplJ Large ribosomal subunit protein uL10 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHE6 2.72e-18 80 33 2 166 3 rplJ Large ribosomal subunit protein uL10 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U036 2.72e-18 80 33 2 166 3 rplJ Large ribosomal subunit protein uL10 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AKY4 2.72e-18 80 33 2 166 3 rplJ Large ribosomal subunit protein uL10 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KGD1 2.72e-18 80 33 2 166 3 rplJ Large ribosomal subunit protein uL10 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P66045 2.72e-18 80 33 2 166 3 rplJ Large ribosomal subunit protein uL10 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q89J72 2.78e-18 80 35 2 168 3 rplJ Large ribosomal subunit protein uL10 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q048U4 2.88e-18 80 33 1 139 3 rplJ Large ribosomal subunit protein uL10 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G904 2.88e-18 80 33 1 139 3 rplJ Large ribosomal subunit protein uL10 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
A5VC07 3.14e-18 80 31 2 167 3 rplJ Large ribosomal subunit protein uL10 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A2BNZ7 3.62e-18 80 30 1 140 3 rplJ Large ribosomal subunit protein uL10 Prochlorococcus marinus (strain AS9601)
Q74L09 4.63e-18 79 32 1 139 3 rplJ Large ribosomal subunit protein uL10 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q7V383 4.72e-18 79 30 1 140 3 rplJ Large ribosomal subunit protein uL10 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q4A5Y9 5.31e-18 79 32 4 151 3 rplJ Large ribosomal subunit protein uL10 Mycoplasmopsis synoviae (strain 53)
B5Y932 6.36e-18 79 31 1 169 3 rplJ Large ribosomal subunit protein uL10 Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
P29343 6.92e-18 79 33 2 163 3 rplJ Large ribosomal subunit protein uL10 Streptomyces antibioticus
B2S2I6 9.84e-18 79 33 3 143 3 rplJ Large ribosomal subunit protein uL10 Treponema pallidum subsp. pallidum (strain SS14)
O83267 9.84e-18 79 33 3 143 3 rplJ Large ribosomal subunit protein uL10 Treponema pallidum (strain Nichols)
Q1GK51 1.03e-17 79 33 1 136 3 rplJ Large ribosomal subunit protein uL10 Ruegeria sp. (strain TM1040)
B0CAD1 1.38e-17 78 28 2 176 3 rplJ Large ribosomal subunit protein uL10 Acaryochloris marina (strain MBIC 11017)
A2BUH9 1.53e-17 78 30 1 140 3 rplJ Large ribosomal subunit protein uL10 Prochlorococcus marinus (strain MIT 9515)
Q6NJG6 1.82e-17 78 35 2 151 3 rplJ Large ribosomal subunit protein uL10 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q1QN46 1.82e-17 78 33 2 168 3 rplJ Large ribosomal subunit protein uL10 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A5FZX3 2.07e-17 78 34 3 165 3 rplJ Large ribosomal subunit protein uL10 Acidiphilium cryptum (strain JF-5)
Q5FTX5 2.09e-17 78 31 2 172 3 rplJ Large ribosomal subunit protein uL10 Gluconobacter oxydans (strain 621H)
B1ZGR8 2.18e-17 77 35 2 150 3 rplJ Large ribosomal subunit protein uL10 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B8IS75 2.55e-17 77 35 2 146 3 rplJ Large ribosomal subunit protein uL10 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q4A7A7 2.78e-17 77 31 0 137 3 rplJ Large ribosomal subunit protein uL10 Mesomycoplasma hyopneumoniae (strain 7448)
B4R8K3 2.87e-17 77 31 3 154 3 rplJ Large ribosomal subunit protein uL10 Phenylobacterium zucineum (strain HLK1)
Q3AGT1 3.16e-17 77 31 1 140 3 rplJ Large ribosomal subunit protein uL10 Synechococcus sp. (strain CC9605)
B1LY45 3.22e-17 77 35 2 150 3 rplJ Large ribosomal subunit protein uL10 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q5NPK9 3.51e-17 77 39 2 142 3 rplJ Large ribosomal subunit protein uL10 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B3QC02 3.74e-17 77 35 2 151 3 rplJ Large ribosomal subunit protein uL10 Rhodopseudomonas palustris (strain TIE-1)
Q9L5W5 4.72e-17 77 30 2 159 3 rplJ Large ribosomal subunit protein uL10 Liberibacter africanus subsp. capensis
P41103 4.99e-17 77 31 2 167 3 rplJ Large ribosomal subunit protein uL10 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q6N4R7 5.07e-17 77 35 2 151 1 rplJ Large ribosomal subunit protein uL10 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q7U3T8 6.92e-17 76 30 1 140 3 rplJ Large ribosomal subunit protein uL10 Parasynechococcus marenigrum (strain WH8102)
B1XJH0 7.07e-17 76 28 3 176 3 rplJ Large ribosomal subunit protein uL10 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q5FM13 7.53e-17 76 30 1 142 3 rplJ Large ribosomal subunit protein uL10 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
C5C0K5 9.03e-17 76 34 2 166 3 rplJ Large ribosomal subunit protein uL10 Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q07KK5 9.32e-17 76 35 2 151 3 rplJ Large ribosomal subunit protein uL10 Rhodopseudomonas palustris (strain BisA53)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_17565
Feature type CDS
Gene rplJ
Product 50S ribosomal protein L10
Location 3560 - 4057 (strand: 1)
Length 498 (nucleotides) / 165 (amino acids)

Contig

Accession contig_29
Length 39360 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2287
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00466 Ribosomal protein L10

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0244 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L10

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02864 large subunit ribosomal protein L10 Ribosome -

Protein Sequence

MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTGLRKACREAGVTVRVVRNTLLRRAVEGTSSECLKDVFVGPTLIAFSHEHPGAAARLFKEFAKANPAFEIKAAAFEGELIAAKDIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAALRDQKEAA

Flanking regions ( +/- flanking 50bp)

AAGTGAGTTCCGGGGTTGTATTACCCGGCTAAACCAGGAGCAAGAAGCTAATGGCATTAAATCTTCAAGACAAACAAGCGATTGTTGCTGAAGTCAGCGAAGTTGCCAAAGGTGCGCTGTCTGCAGTTGTCGCGGATTCCCGTGGTGTGACTGTAGATAAAATGACCGGTCTGCGTAAAGCATGTCGTGAAGCTGGCGTTACTGTACGTGTAGTACGTAACACCCTGCTGCGTCGTGCTGTTGAAGGTACCTCTTCTGAGTGCCTGAAAGACGTATTCGTCGGTCCTACCTTGATTGCATTTTCTCATGAACATCCGGGCGCTGCTGCTCGTCTGTTCAAAGAATTCGCGAAAGCGAACCCTGCATTCGAGATTAAAGCCGCAGCCTTTGAAGGTGAGTTAATTGCAGCGAAAGATATCGATCGCTTAGCAACACTCCCGACTTACGAAGAAGCAATCGCGCGCCTGATGGCAACCATGAAAGAAGCCTCTGCAGGCAAACTGGTTCGCACTCTGGCAGCGTTACGCGATCAGAAAGAAGCAGCTTAATTGCCCTTTCTTTTCTTCGTTGCTTTTTAACGTATAAACTTATTCTGAAT