Homologs in group_2239

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_01745 EHELCC_01745 100.0 Morganella morganii S2 pncA Nicotinamidase-related amidase
NLDBIP_01715 NLDBIP_01715 100.0 Morganella morganii S4 pncA Nicotinamidase-related amidase
LHKJJB_00320 LHKJJB_00320 100.0 Morganella morganii S3 pncA Nicotinamidase-related amidase
HKOGLL_00360 HKOGLL_00360 100.0 Morganella morganii S5 pncA Nicotinamidase-related amidase
F4V73_RS08900 F4V73_RS08900 37.6 Morganella psychrotolerans - cysteine hydrolase family protein
PMI_RS02000 PMI_RS02000 30.8 Proteus mirabilis HI4320 - isochorismatase family cysteine hydrolase

Distribution of the homologs in the orthogroup group_2239

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2239

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADI7 1.11e-14 72 31 5 189 1 yecD Isochorismatase family protein YecD Escherichia coli (strain K12)
P0ADI8 1.11e-14 72 31 5 189 3 yecD Uncharacterized isochorismatase family protein YecD Escherichia coli O157:H7
A0A2N6JFX7 1.07e-11 64 29 5 200 1 trtA Triuret hydrolase TrtA Herbaspirillum sp. (strain BH-1)
Q1M7F4 3.11e-10 60 25 4 195 1 biuH Biuret amidohydrolase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q93Z51 1.43e-08 55 29 6 171 2 At3g16190 Probable inactive nicotinamidase At3g16190 Arabidopsis thaliana
P94573 3.42e-08 54 25 4 190 3 ywoC Uncharacterized isochorismatase family protein YwoC Bacillus subtilis (strain 168)
A4W924 1.71e-07 53 25 4 179 3 rutB Ureidoacrylate amidohydrolase RutB Enterobacter sp. (strain 638)
B5XXN1 1.9e-07 52 25 4 170 3 rutB Ureidoacrylate amidohydrolase RutB Klebsiella pneumoniae (strain 342)
A6T7A1 3.37e-07 52 25 4 170 3 rutB Ureidoacrylate amidohydrolase RutB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
D3RKL1 3.44e-07 52 25 4 170 3 rutB Ureidoacrylate amidohydrolase RutB Klebsiella variicola (strain At-22)
D5CE33 3.5e-07 52 25 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCTC 10005 / WDCM 00083 / NCDC 279-56)
Q0TJ56 4.55e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N3G7 4.68e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
D3H124 4.68e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O44:H18 (strain 042 / EAEC)
B1IV86 4.9e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZYW6 4.9e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O9:H4 (strain HS)
B7M8Z6 4.96e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O8 (strain IAI1)
B7LFC1 4.96e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain 55989 / EAEC)
C8TNC1 4.96e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O26:H11 (strain 11368 / EHEC)
C8UMM7 4.96e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O111:H- (strain 11128 / EHEC)
Q8FJ42 5.05e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
C6UFC2 5.31e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain B / REL606)
C6EHJ6 5.31e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain B / BL21-DE3)
B6I987 5.47e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain SE11)
C8U5H3 5.47e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O103:H2 (strain 12009 / EHEC)
A8GCT5 5.53e-07 51 28 5 165 3 rutB Ureidoacrylate amidohydrolase RutB Serratia proteamaculans (strain 568)
D2NGI8 5.58e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O150:H5 (strain SE15)
A7ZKB6 5.67e-07 51 24 6 203 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3Z3A3 5.95e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Shigella sonnei (strain Ss046)
D3QPK4 5.95e-07 51 24 6 203 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O55:H7 (strain CB9615 / EPEC)
B7MTF4 6.09e-07 51 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O81 (strain ED1a)
P75897 6.15e-07 51 25 4 170 1 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain K12)
B1X9D2 6.15e-07 51 25 4 170 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain K12 / DH10B)
C9QZ65 6.15e-07 51 25 4 170 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain ATCC 33849 / DSM 4235 / NCIMB 12045 / K12 / DH1)
C4ZQD9 6.15e-07 51 25 4 170 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain K12 / MC4100 / BW2952)
Q97TR7 9.74e-07 50 25 4 192 3 CA_P0030 Uncharacterized isochorismatase family protein CA_P0030 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B7UNZ4 1.11e-06 50 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
D5CZH1 1.22e-06 50 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O18:K1:H7 (strain IHE3034 / ExPEC)
Q6FFZ6 1.31e-06 50 23 6 202 3 rutB Ureidoacrylate amidohydrolase RutB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B7MIF8 1.31e-06 50 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O45:K1 (strain S88 / ExPEC)
Q1RDK6 1.33e-06 50 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain UTI89 / UPEC)
A1A9R6 1.33e-06 50 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O1:K1 / APEC
B7NLB5 1.63e-06 50 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B0SW60 1.74e-06 50 25 4 170 3 rutB Ureidoacrylate amidohydrolase RutB Caulobacter sp. (strain K31)
B1LIZ4 2.11e-06 49 24 4 181 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain SMS-3-5 / SECEC)
A7ME53 2.68e-06 49 24 4 170 3 rutB Ureidoacrylate amidohydrolase RutB Cronobacter sakazakii (strain ATCC BAA-894)
A1JMX8 3.4e-06 49 26 4 169 3 rutB Ureidoacrylate amidohydrolase RutB Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C9Y0S6 4.22e-06 48 24 4 170 3 rutB Ureidoacrylate amidohydrolase RutB Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)
B5YU52 4.31e-06 48 24 4 170 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O157:H7 (strain EC4115 / EHEC)
C6UPN3 4.72e-06 48 24 6 203 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O157:H7 (strain TW14359 / EHEC)
Q8XAU3 4.72e-06 48 24 6 203 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O157:H7
P96654 8.94e-06 47 25 4 169 3 yddQ Uncharacterized isochorismatase family protein YddQ Bacillus subtilis (strain 168)
Q0T623 9.51e-06 48 24 5 165 3 rutB Ureidoacrylate amidohydrolase RutB Shigella flexneri serotype 5b (strain 8401)
Q83RV3 1.03e-05 48 24 5 165 3 rutB Ureidoacrylate amidohydrolase RutB Shigella flexneri
D2AC42 1.03e-05 48 24 5 165 3 rutB Ureidoacrylate amidohydrolase RutB Shigella flexneri serotype X (strain 2002017)
D0LI56 1.77e-05 47 26 6 188 3 rutB Ureidoacrylate amidohydrolase RutB Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2)
D4GWH7 5.88e-05 45 29 2 125 1 HVO_2328 Uncharacterized isochorismatase family protein HVO_2328 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
G2X4M1 0.000445 42 27 5 155 1 Isc1 Secreted isochorismatase effector Isc1 Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137)
D4GEU5 0.00046 43 27 6 185 3 rutB Ureidoacrylate amidohydrolase RutB Pantoea ananatis (strain LMG 20103)
D5VGV1 0.000468 43 27 4 168 3 rutB Ureidoacrylate amidohydrolase RutB Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059)
C5CN80 0.000581 42 27 4 170 3 rutB Ureidoacrylate amidohydrolase RutB Variovorax paradoxus (strain S110)
Q9FMX7 0.001 42 35 0 68 1 NIC2 Nicotinamidase 2 Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_17145
Feature type CDS
Gene pncA
Product Nicotinamidase-related amidase
Location 14338 - 14910 (strand: 1)
Length 573 (nucleotides) / 190 (amino acids)

Contig

Accession contig_27
Length 46634 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2239
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00857 Isochorismatase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1335 Coenzyme transport and metabolism (H)
General function prediction only (R)		 HR Nicotinamidase-related amidase

Protein Sequence

MKQALIIIDLINDITGKHGLSNACHEQTAARNLIAATRETARQARLRDIPVVWVRVGFADDWHDIPAGSPMFQRAKEIGALKLSSSGCDWADGTDVQKEDVCFVKKGVSAFAGNDLLIWLRKAGIEHLVLAGVSTVMAIQSTARYAHDSGFYVSVAEDLCAAPTAELHQISLEMLRPMAAITTSAAWLAQ

Flanking regions ( +/- flanking 50bp)

AGTTCTGATACATAAGGCTATGCTGAAAAAAGTCAGAACAGGAGGGACAGATGAAACAGGCACTGATTATTATCGACCTTATTAATGACATTACCGGCAAACACGGGCTTTCCAACGCCTGCCATGAGCAGACTGCCGCCCGTAACCTGATTGCGGCCACACGGGAAACCGCCCGTCAGGCGCGGCTGCGGGACATCCCCGTGGTGTGGGTGCGGGTCGGGTTTGCTGATGACTGGCATGATATCCCCGCCGGATCACCGATGTTTCAGCGGGCAAAAGAGATTGGTGCCCTGAAACTGAGCAGCAGCGGTTGTGACTGGGCAGACGGTACGGATGTGCAGAAAGAGGATGTCTGTTTTGTGAAGAAAGGCGTCAGTGCCTTTGCGGGAAATGATTTGCTGATCTGGCTGCGCAAAGCCGGGATTGAACACCTTGTTCTGGCCGGTGTCAGCACGGTGATGGCCATTCAGAGCACCGCGCGTTATGCCCACGACAGCGGGTTTTATGTCTCGGTAGCGGAGGATTTGTGTGCCGCCCCGACAGCGGAACTGCACCAGATAAGTCTGGAGATGCTCCGCCCGATGGCAGCTATCACCACATCCGCCGCCTGGCTGGCACAATAACCTTTTATTATCCGCGCAGAGATACTGCGCGGATCTCTCTGTTTACCACA