Homologs in group_2239

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_19555 EHELCC_19555 100.0 Morganella morganii S2 yIH1 IMPACT family protein
NLDBIP_16925 NLDBIP_16925 100.0 Morganella morganii S4 yIH1 IMPACT family protein
LHKJJB_16545 LHKJJB_16545 100.0 Morganella morganii S3 yIH1 IMPACT family protein
HKOGLL_17510 HKOGLL_17510 100.0 Morganella morganii S5 yIH1 IMPACT family protein
F4V73_RS18345 F4V73_RS18345 87.3 Morganella psychrotolerans - IMPACT family protein
PMI_RS17650 PMI_RS17650 65.6 Proteus mirabilis HI4320 - IMPACT family protein

Distribution of the homologs in the orthogroup group_2239

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2239

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P27862 5.27e-74 224 63 0 185 1 yigZ IMPACT family member YigZ Escherichia coli (strain K12)
P44842 2.92e-59 187 52 0 184 3 HI_0722 IMPACT family member HI_0722 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P32437 7.15e-33 120 35 3 185 3 yvyE IMPACT family member YvyE Bacillus subtilis (strain 168)
P32438 3.45e-12 65 29 5 181 3 None IMPACT family member in pol 5'region (Fragment) Thermus thermophilus

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_16875
Feature type CDS
Gene yIH1
Product IMPACT family protein
Location 2188 - 2781 (strand: -1)
Length 594 (nucleotides) / 197 (amino acids)
In genomic island -

Contig

Accession contig_26
Length 47760 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2239
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01205 Uncharacterized protein family UPF0029
PF09186 Domain of unknown function (DUF1949)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1739 General function prediction only (R) R Putative translation regulator, IMPACT (imprinted ancient) protein family

Protein Sequence

MFTEEIKKSRFITLLQHTDGVDEAKQFIQSVKDEYPDARHHCWAFVAGRPDDSQQLGFSDDGEPTGTAGKPMIAPLLGSGIGEITAVVVRYFGGIKLGTGGLVRAYGSGVQQALKLLVTKTKIPQVICEITCDYSFISQAELVVRQVDGTIINSDFGSDVTLRISIPATLLSEVSDKLRDLSRGMFELKCPDDTTGN

Flanking regions ( +/- flanking 50bp)

GATCTGAATCTGCCGTAATGAAATCGTACCTTATACCGGCTGAGCCGGTTATGTTTACTGAAGAGATAAAAAAAAGCCGTTTCATCACCCTGTTGCAGCATACGGACGGGGTGGATGAAGCAAAGCAATTTATTCAGTCTGTCAAAGATGAATATCCCGATGCCCGGCACCATTGCTGGGCATTTGTTGCGGGGCGTCCGGATGATTCTCAGCAACTGGGATTTTCTGATGACGGTGAGCCGACCGGAACAGCAGGTAAACCGATGATTGCACCGCTGCTCGGCAGCGGAATCGGGGAAATTACGGCGGTGGTTGTCCGCTATTTCGGCGGAATAAAATTAGGCACCGGCGGGCTGGTTCGTGCATACGGCAGCGGGGTTCAGCAGGCACTGAAACTGCTGGTAACGAAAACTAAAATCCCGCAGGTGATCTGTGAAATAACCTGTGATTACAGCTTTATCAGCCAGGCAGAATTAGTGGTCCGGCAGGTGGATGGTACGATAATCAACAGTGATTTCGGTTCGGATGTGACGTTACGTATTTCGATTCCTGCTACCTTACTGAGTGAGGTTAGTGATAAATTACGTGACCTGAGCCGGGGGATGTTTGAGCTTAAATGCCCTGATGACACCACCGGAAACTGATTTCTGAGGACTCTGCTGCAATGCATTTTCGCGCCATAACCCGTATTGTC