Homologs in group_3995

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_3995

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3995

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P12552 5.53e-08 48 33 3 80 4 None Uncharacterized protein ORF88 Enterobacteria phage P4

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_16620
Feature type CDS
Gene alpA
Product AlpA family transcriptional regulator
Location 8427 - 8648 (strand: -1)
Length 222 (nucleotides) / 73 (amino acids)
In genomic island -

Contig

Accession contig_25
Length 47933 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3995
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF05930 Prophage CP4-57 regulatory protein (AlpA)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3311 Transcription (K)
Mobilome: prophages, transposons (X)		 KX DNA-binding transcriptional regulator AlpA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07733 prophage regulatory protein - -

Protein Sequence

MNTTDTTTAPSPLDDPLVDMKEITKLTGLTDKWFYKLIQDGQFPKPIKLGNRSRWLTSEVDAWLQARIVESRG

Flanking regions ( +/- flanking 50bp)

CATCGATAGCACTTCTGCCTTTTTAATTAAACAAAGACAGGAGATTCCCCATGAATACCACTGATACCACCACAGCCCCTTCTCCGCTTGACGACCCGCTCGTGGACATGAAAGAGATCACGAAATTAACCGGATTAACGGACAAGTGGTTTTACAAGCTGATCCAGGACGGTCAGTTCCCGAAACCGATTAAACTGGGAAACCGTTCCCGGTGGCTGACAAGTGAGGTTGACGCCTGGCTGCAGGCCCGTATTGTGGAGTCCCGGGGATAAGGCCGGGCTTTCACACTTCTTTTCCTGCCGTCTGTCCGGCTCTGACACCC