Homologs in group_2195

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_16285 EHELCC_16285 100.0 Morganella morganii S2 rpmG 50S ribosomal protein L33
NLDBIP_17055 NLDBIP_17055 100.0 Morganella morganii S4 rpmG 50S ribosomal protein L33
LHKJJB_16975 LHKJJB_16975 100.0 Morganella morganii S3 rpmG 50S ribosomal protein L33
HKOGLL_16865 HKOGLL_16865 100.0 Morganella morganii S5 rpmG 50S ribosomal protein L33
F4V73_RS17345 F4V73_RS17345 96.4 Morganella psychrotolerans rpmG 50S ribosomal protein L33
PMI_RS15615 PMI_RS15615 94.5 Proteus mirabilis HI4320 rpmG 50S ribosomal protein L33

Distribution of the homologs in the orthogroup group_2195

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2195

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MY30 3.9e-32 107 94 0 55 3 rpmG Large ribosomal subunit protein bL33 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4F0X0 1.29e-31 106 94 0 55 3 rpmG Large ribosomal subunit protein bL33 Proteus mirabilis (strain HI4320)
A4W513 1.47e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Enterobacter sp. (strain 638)
A7MQ96 1.47e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Cronobacter sakazakii (strain ATCC BAA-894)
Q3YVZ8 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Shigella sonnei (strain Ss046)
P0A7P4 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Shigella flexneri
Q0SYG4 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Shigella flexneri serotype 5b (strain 8401)
Q329M1 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Shigella dysenteriae serotype 1 (strain Sd197)
Q31UZ0 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Shigella boydii serotype 4 (strain Sb227)
B2TTV0 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P0A7P2 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A7P3 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Salmonella typhi
B4TZX8 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Salmonella schwarzengrund (strain CVM19633)
B5BI10 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Salmonella paratyphi A (strain AKU_12601)
C0Q1W9 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Salmonella paratyphi C (strain RKS4594)
A9MVN1 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PC32 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SXD8 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Salmonella newport (strain SL254)
B4T9C1 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Salmonella heidelberg (strain SL476)
B5RGF1 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5G0 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Salmonella enteritidis PT4 (strain P125109)
B5FM60 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Salmonella dublin (strain CT_02021853)
Q57IA6 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Salmonella choleraesuis (strain SC-B67)
A9MKN8 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5EXE1 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Salmonella agona (strain SL483)
B7LVJ7 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B2VF69 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q1R4V6 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli (strain UTI89 / UPEC)
B1LK73 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli (strain SMS-3-5 / SECEC)
B6I3L3 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli (strain SE11)
B7NEU0 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7N9 2.3e-30 103 90 0 55 1 rpmG Large ribosomal subunit protein bL33 Escherichia coli (strain K12)
B1IZF7 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7P0 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBH3 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A698 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli O9:H4 (strain HS)
B1X970 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli (strain K12 / DH10B)
C4ZXM8 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4C0 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli O8 (strain IAI1)
B7N276 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli O81 (strain ED1a)
B7NPE2 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YWD4 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7P1 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli O157:H7
B7L759 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli (strain 55989 / EAEC)
B7MFJ7 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7ULJ1 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTI7 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Escherichia coli O139:H28 (strain E24377A / ETEC)
A8ARM4 2.3e-30 103 90 0 55 3 rpmG Large ribosomal subunit protein bL33 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B1JQX1 2.4e-30 103 89 0 55 3 rpmG Large ribosomal subunit protein bL33 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66GD4 2.4e-30 103 89 0 55 3 rpmG Large ribosomal subunit protein bL33 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TSD5 2.4e-30 103 89 0 55 3 rpmG Large ribosomal subunit protein bL33 Yersinia pestis (strain Pestoides F)
Q1CD04 2.4e-30 103 89 0 55 3 rpmG Large ribosomal subunit protein bL33 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R676 2.4e-30 103 89 0 55 3 rpmG Large ribosomal subunit protein bL33 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJP1 2.4e-30 103 89 0 55 3 rpmG Large ribosomal subunit protein bL33 Yersinia pestis
B2JYN5 2.4e-30 103 89 0 55 3 rpmG Large ribosomal subunit protein bL33 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C269 2.4e-30 103 89 0 55 3 rpmG Large ribosomal subunit protein bL33 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FCT6 2.4e-30 103 89 0 55 3 rpmG Large ribosomal subunit protein bL33 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6DAV5 2.4e-30 103 89 0 55 3 rpmG Large ribosomal subunit protein bL33 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JHR4 3.73e-30 102 89 0 55 3 rpmG Large ribosomal subunit protein bL33 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GLE3 3.73e-30 102 89 0 55 3 rpmG Large ribosomal subunit protein bL33 Serratia proteamaculans (strain 568)
C6DIB9 4.45e-30 102 89 0 55 3 rpmG Large ribosomal subunit protein bL33 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5B9D7 7.45e-30 102 89 0 55 3 rpmG Large ribosomal subunit protein bL33 Edwardsiella ictaluri (strain 93-146)
Q2NQU3 1.17e-29 101 87 0 55 3 rpmG Large ribosomal subunit protein bL33 Sodalis glossinidius (strain morsitans)
A6TFM7 2.26e-29 100 87 0 55 3 rpmG Large ribosomal subunit protein bL33 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XTG7 2.26e-29 100 87 0 55 3 rpmG Large ribosomal subunit protein bL33 Klebsiella pneumoniae (strain 342)
A4STD3 8.26e-29 99 85 0 55 3 rpmG Large ribosomal subunit protein bL33 Aeromonas salmonicida (strain A449)
A0KEN0 8.26e-29 99 85 0 55 3 rpmG Large ribosomal subunit protein bL33 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B7VHK4 1.82e-28 98 85 0 55 3 rpmG Large ribosomal subunit protein bL33 Vibrio atlanticus (strain LGP32)
Q6LVN2 1.82e-28 98 85 0 55 3 rpmG Large ribosomal subunit protein bL33 Photobacterium profundum (strain SS9)
C4L812 5.29e-28 97 83 0 55 3 rpmG Large ribosomal subunit protein bL33 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q605E4 2.76e-27 95 88 0 51 3 rpmG Large ribosomal subunit protein bL33 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
C3LQI1 2.78e-27 95 81 0 55 3 rpmG Large ribosomal subunit protein bL33 Vibrio cholerae serotype O1 (strain M66-2)
Q9KVC7 2.78e-27 95 81 0 55 3 rpmG Large ribosomal subunit protein bL33 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F405 2.78e-27 95 81 0 55 3 rpmG Large ribosomal subunit protein bL33 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B0TQL3 3.12e-27 95 85 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella halifaxensis (strain HAW-EB4)
B0BTZ7 4.77e-27 94 85 0 54 3 rpmG Large ribosomal subunit protein bL33 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H342 4.77e-27 94 85 0 54 3 rpmG Large ribosomal subunit protein bL33 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N3R0 4.77e-27 94 85 0 54 3 rpmG Large ribosomal subunit protein bL33 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A8H9A8 5e-27 94 83 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q2SN71 5.82e-27 94 88 0 51 3 rpmG Large ribosomal subunit protein bL33 Hahella chejuensis (strain KCTC 2396)
B0UUW9 7.49e-27 94 83 0 54 3 rpmG Large ribosomal subunit protein bL33 Histophilus somni (strain 2336)
Q0I0X7 7.49e-27 94 83 0 54 3 rpmG Large ribosomal subunit protein bL33 Histophilus somni (strain 129Pt)
Q7VN53 8.54e-27 94 85 0 54 3 rpmG Large ribosomal subunit protein bL33 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B8F859 1.03e-26 94 85 0 54 3 rpmG Large ribosomal subunit protein bL33 Glaesserella parasuis serovar 5 (strain SH0165)
Q87T84 1.21e-26 94 83 0 53 3 rpmG Large ribosomal subunit protein bL33 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MSP9 1.21e-26 94 83 0 53 3 rpmG Large ribosomal subunit protein bL33 Vibrio campbellii (strain ATCC BAA-1116)
Q65R60 1.43e-26 93 83 0 54 3 rpmG Large ribosomal subunit protein bL33 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B6EPP1 2.61e-26 92 80 0 55 3 rpmG Large ribosomal subunit protein bL33 Aliivibrio salmonicida (strain LFI1238)
C4K7G1 2.79e-26 92 80 0 55 3 rpmG Large ribosomal subunit protein bL33 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A6VKA0 2.96e-26 92 81 0 54 3 rpmG Large ribosomal subunit protein bL33 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P57912 3.98e-26 92 83 0 54 3 rpmG Large ribosomal subunit protein bL33 Pasteurella multocida (strain Pm70)
B1KL03 4.35e-26 92 81 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella woodyi (strain ATCC 51908 / MS32)
A8FQ77 4.35e-26 92 81 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella sediminis (strain HAW-EB3)
B8CM31 4.35e-26 92 81 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q07WG3 4.35e-26 92 81 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella frigidimarina (strain NCIMB 400)
Q12SF3 4.35e-26 92 81 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
P44369 4.96e-26 92 81 0 54 3 rpmG Large ribosomal subunit protein bL33 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UI92 4.96e-26 92 81 0 54 3 rpmG Large ribosomal subunit protein bL33 Haemophilus influenzae (strain PittGG)
A5UDB8 4.96e-26 92 81 0 54 3 rpmG Large ribosomal subunit protein bL33 Haemophilus influenzae (strain PittEE)
Q4QLV7 4.96e-26 92 81 0 54 3 rpmG Large ribosomal subunit protein bL33 Haemophilus influenzae (strain 86-028NP)
A1S2D4 5.08e-26 92 81 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A6VSY5 5.35e-26 92 79 0 54 3 rpmG Large ribosomal subunit protein bL33 Marinomonas sp. (strain MWYL1)
A1REU6 6.54e-26 92 81 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella sp. (strain W3-18-1)
A4Y2L3 6.54e-26 92 81 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A3QIP7 6.54e-26 92 81 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B5FFF8 8.95e-26 91 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Aliivibrio fischeri (strain MJ11)
Q5E8M3 8.95e-26 91 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q1QT93 1.22e-25 91 84 0 51 3 rpmG Large ribosomal subunit protein bL33 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0VT56 1.45e-25 91 81 0 55 3 rpmG Large ribosomal subunit protein bL33 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A4JH23 1.6e-25 90 80 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BUB0 1.6e-25 90 80 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia orbicola (strain AU 1054)
B1JXB4 1.6e-25 90 80 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia orbicola (strain MC0-3)
Q39DN7 1.6e-25 90 80 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BCL7 1.6e-25 90 80 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A0K9S6 1.6e-25 90 80 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia cenocepacia (strain HI2424)
B1YV95 1.6e-25 90 80 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia ambifaria (strain MC40-6)
Q0HZU1 2.17e-25 90 79 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella sp. (strain MR-7)
Q0HE58 2.17e-25 90 79 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella sp. (strain MR-4)
A0L1R7 2.17e-25 90 79 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella sp. (strain ANA-3)
Q8E9M4 2.17e-25 90 79 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9KY06 2.17e-25 90 79 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella baltica (strain OS195)
A6WIA8 2.17e-25 90 79 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella baltica (strain OS185)
A3CZJ8 2.17e-25 90 79 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E4J7 2.17e-25 90 79 0 54 3 rpmG Large ribosomal subunit protein bL33 Shewanella baltica (strain OS223)
A9HWU6 2.23e-25 90 80 0 55 3 rpmG Large ribosomal subunit protein bL33 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q7W9M0 2.23e-25 90 80 0 55 3 rpmG Large ribosomal subunit protein bL33 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WH38 2.23e-25 90 80 0 55 3 rpmG Large ribosomal subunit protein bL33 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2KXH7 2.23e-25 90 80 0 55 3 rpmG Large ribosomal subunit protein bL33 Bordetella avium (strain 197N)
Q3J7V2 2.33e-25 90 84 0 51 3 rpmG Large ribosomal subunit protein bL33 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A5EWV9 2.94e-25 90 79 0 53 3 rpmG Large ribosomal subunit protein bL33 Dichelobacter nodosus (strain VCS1703A)
B2JDZ8 3.45e-25 90 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q2T0G4 3.45e-25 90 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63WH4 3.45e-25 90 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia pseudomallei (strain K96243)
A3N6Q7 3.45e-25 90 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia pseudomallei (strain 668)
Q3JV55 3.45e-25 90 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia pseudomallei (strain 1710b)
A3NSE2 3.45e-25 90 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia pseudomallei (strain 1106a)
A1V6U2 3.45e-25 90 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia mallei (strain SAVP1)
Q62HM4 3.45e-25 90 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia mallei (strain ATCC 23344)
A2S4Z0 3.45e-25 90 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia mallei (strain NCTC 10229)
A3MMZ6 3.45e-25 90 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia mallei (strain NCTC 10247)
A9AHD4 3.45e-25 90 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia multivorans (strain ATCC 17616 / 249)
Q13UX1 4.16e-25 90 80 0 55 3 rpmG Large ribosomal subunit protein bL33 Paraburkholderia xenovorans (strain LB400)
B2T6H8 4.16e-25 90 80 0 55 3 rpmG Large ribosomal subunit protein bL33 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A1K4J7 4.4e-25 89 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Azoarcus sp. (strain BH72)
B0U0G0 6.21e-25 89 84 0 51 3 rpmG Large ribosomal subunit protein bL33 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q3SFR3 6.25e-25 89 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Thiobacillus denitrificans (strain ATCC 25259)
Q1H4K5 6.63e-25 89 82 0 51 3 rpmG Large ribosomal subunit protein bL33 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q5P1Z8 8.89e-25 89 76 0 55 3 rpmG Large ribosomal subunit protein bL33 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q7MPS5 9.73e-25 89 79 0 53 3 rpmG Large ribosomal subunit protein bL33 Vibrio vulnificus (strain YJ016)
Q8DDY2 9.73e-25 89 79 0 53 3 rpmG Large ribosomal subunit protein bL33 Vibrio vulnificus (strain CMCP6)
Q5QZC4 1.41e-24 88 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q7NSH1 1.84e-24 88 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q48AD6 2.06e-24 88 78 0 51 3 rpmG Large ribosomal subunit protein bL33 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q7VWY2 2.07e-24 88 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B4E8Y8 2.47e-24 88 78 0 55 3 rpmG Large ribosomal subunit protein bL33 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q0AHY2 2.48e-24 87 82 0 51 3 rpmG Large ribosomal subunit protein bL33 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1U6L6 3.05e-24 87 82 0 51 3 rpmG Large ribosomal subunit protein bL33 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q1LJD2 3.97e-24 87 77 0 54 3 rpmG Large ribosomal subunit protein bL33 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B3R6D7 4.06e-24 87 77 0 54 3 rpmG Large ribosomal subunit protein bL33 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q46XN8 4.06e-24 87 77 0 54 3 rpmG Large ribosomal subunit protein bL33 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0K7B1 4.06e-24 87 77 0 54 3 rpmG Large ribosomal subunit protein bL33 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A1SR13 4.9e-24 87 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B3PG60 5.06e-24 87 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Cellvibrio japonicus (strain Ueda107)
A1AXP2 6.51e-24 86 82 0 51 3 rpmG Large ribosomal subunit protein bL33 Ruthia magnifica subsp. Calyptogena magnifica
B8D6Z3 6.78e-24 87 69 0 55 3 rpmG Large ribosomal subunit protein bL33 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D8N9 6.78e-24 87 69 0 55 3 rpmG Large ribosomal subunit protein bL33 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A4SZN4 7.91e-24 86 74 0 55 3 rpmG Large ribosomal subunit protein bL33 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A4IWH6 9.26e-24 86 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NEM2 9.26e-24 86 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BN38 9.26e-24 86 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q4S3 9.26e-24 86 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Francisella tularensis subsp. novicida (strain U112)
B2SFL4 9.26e-24 86 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A4R2 9.26e-24 86 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Francisella tularensis subsp. holarctica (strain LVS)
A7NAM3 9.26e-24 86 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14G25 9.26e-24 86 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Francisella tularensis subsp. tularensis (strain FSC 198)
P57187 1.04e-23 86 69 0 55 3 rpmG Large ribosomal subunit protein bL33 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B0V4N2 1.07e-23 86 76 0 51 3 rpmG Large ribosomal subunit protein bL33 Acinetobacter baumannii (strain AYE)
A3M1V8 1.07e-23 86 76 0 51 3 rpmG Large ribosomal subunit protein bL33 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VL80 1.07e-23 86 76 0 51 3 rpmG Large ribosomal subunit protein bL33 Acinetobacter baumannii (strain SDF)
B2I391 1.07e-23 86 76 0 51 3 rpmG Large ribosomal subunit protein bL33 Acinetobacter baumannii (strain ACICU)
Q6FET0 1.07e-23 86 76 0 51 3 rpmG Large ribosomal subunit protein bL33 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q88CA0 1.36e-23 85 78 0 51 3 rpmG Large ribosomal subunit protein bL33 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A1WZG4 1.5e-23 85 75 0 54 3 rpmG Large ribosomal subunit protein bL33 Halorhodospira halophila (strain DSM 244 / SL1)
A1KVW1 1.5e-23 85 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66226 1.5e-23 85 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66225 1.5e-23 85 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M2Z9 1.5e-23 85 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Neisseria meningitidis serogroup C (strain 053442)
B1XW21 1.61e-23 85 74 0 55 3 rpmG Large ribosomal subunit protein bL33 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q9HTN9 1.85e-23 85 78 0 51 1 rpmG Large ribosomal subunit protein bL33 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8KA34 2.03e-23 85 67 0 55 3 rpmG Large ribosomal subunit protein bL33 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q88BC7 2.06e-23 85 78 0 51 3 rpmG Large ribosomal subunit protein bL33 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q21EE4 2.21e-23 85 78 0 51 3 rpmG Large ribosomal subunit protein bL33 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q82UL7 3.42e-23 85 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B2SU25 5.71e-23 84 72 0 55 3 rpmG Large ribosomal subunit protein bL33 Xanthomonas oryzae pv. oryzae (strain PXO99A)
B2UAP2 6.25e-23 84 75 0 54 3 rpmG Large ribosomal subunit protein bL33 Ralstonia pickettii (strain 12J)
Q8XWM8 6.25e-23 84 75 0 54 3 rpmG Large ribosomal subunit protein bL33 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B4RNP4 7.14e-23 84 78 0 51 3 rpmG Large ribosomal subunit protein bL33 Neisseria gonorrhoeae (strain NCCP11945)
Q5F683 7.14e-23 84 78 0 51 3 rpmG Large ribosomal subunit protein bL33 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B4S2C4 7.14e-23 84 78 0 51 3 rpmG Large ribosomal subunit protein bL33 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q47BA7 9.16e-23 84 74 0 55 3 rpmG Large ribosomal subunit protein bL33 Dechloromonas aromatica (strain RCB)
Q5GU11 9.68e-23 84 70 0 55 3 rpmG Large ribosomal subunit protein bL33 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NXC6 9.68e-23 84 70 0 55 3 rpmG Large ribosomal subunit protein bL33 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BMM6 9.68e-23 84 70 0 55 3 rpmG Large ribosomal subunit protein bL33 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P66239 9.68e-23 84 70 0 55 3 rpmG Large ribosomal subunit protein bL33 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RYR2 9.68e-23 84 70 0 55 3 rpmG Large ribosomal subunit protein bL33 Xanthomonas campestris pv. campestris (strain B100)
Q4UP62 9.68e-23 84 70 0 55 3 rpmG Large ribosomal subunit protein bL33 Xanthomonas campestris pv. campestris (strain 8004)
P66238 9.68e-23 84 70 0 55 3 rpmG Large ribosomal subunit protein bL33 Xanthomonas axonopodis pv. citri (strain 306)
A5WD02 1.12e-22 83 76 0 51 3 rpmG Large ribosomal subunit protein bL33 Psychrobacter sp. (strain PRwf-1)
A5CVN3 1.48e-22 83 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q2Y738 1.52e-22 83 78 0 51 3 rpmG Large ribosomal subunit protein bL33 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q0A5A5 2.76e-22 82 72 0 51 3 rpmG Large ribosomal subunit protein bL33 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q1Q986 4.19e-22 82 74 0 51 3 rpmG Large ribosomal subunit protein bL33 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FQZ9 4.19e-22 82 74 0 51 3 rpmG Large ribosomal subunit protein bL33 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1LTS5 5.14e-22 82 85 0 55 3 rpmG Large ribosomal subunit protein bL33 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q3IFE7 7.5e-22 81 72 0 51 3 rpmG Large ribosomal subunit protein bL33 Pseudoalteromonas translucida (strain TAC 125)
A9BNV0 7.82e-22 81 74 0 54 3 rpmG Large ribosomal subunit protein bL33 Delftia acidovorans (strain DSM 14801 / SPH-1)
A6T146 8.24e-22 81 74 0 55 3 rpmG Large ribosomal subunit protein bL33 Janthinobacterium sp. (strain Marseille)
A4G7W1 8.33e-22 81 74 0 55 3 rpmG Large ribosomal subunit protein bL33 Herminiimonas arsenicoxydans
B1Y148 1.04e-21 81 72 0 54 3 rpmG Large ribosomal subunit protein bL33 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A1WB80 1.07e-21 81 74 0 54 3 rpmG Large ribosomal subunit protein bL33 Acidovorax sp. (strain JS42)
B9MEB8 1.07e-21 81 74 0 54 3 rpmG Large ribosomal subunit protein bL33 Acidovorax ebreus (strain TPSY)
Q89AY9 2.55e-21 80 67 0 55 3 rpmG Large ribosomal subunit protein bL33 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A2SET8 4.57e-21 79 70 0 55 3 rpmG Large ribosomal subunit protein bL33 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A1WIQ3 6.03e-21 79 68 0 54 3 rpmG Large ribosomal subunit protein bL33 Verminephrobacter eiseniae (strain EF01-2)
Q15ZV7 6.39e-21 79 72 0 51 3 rpmG Large ribosomal subunit protein bL33 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q21TL3 6.51e-21 79 73 0 53 3 rpmG Large ribosomal subunit protein bL33 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1VS85 2.37e-20 77 70 0 55 3 rpmG Large ribosomal subunit protein bL33 Polaromonas naphthalenivorans (strain CJ2)
A1TSP8 2.6e-20 77 71 0 53 3 rpmG Large ribosomal subunit protein bL33 Paracidovorax citrulli (strain AAC00-1)
B2FNE2 5.4e-20 77 65 0 52 3 rpmG Large ribosomal subunit protein bL33 Stenotrophomonas maltophilia (strain K279a)
P66241 1.62e-19 75 67 0 52 3 rpmG Large ribosomal subunit protein bL33 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U5P8 1.62e-19 75 67 0 52 3 rpmG Large ribosomal subunit protein bL33 Xylella fastidiosa (strain M12)
P66240 1.62e-19 75 67 0 52 3 rpmG Large ribosomal subunit protein bL33 Xylella fastidiosa (strain 9a5c)
B2I8L8 1.62e-19 75 67 0 52 3 rpmG Large ribosomal subunit protein bL33 Xylella fastidiosa (strain M23)
A9FNE0 2.52e-19 75 68 0 50 3 rpmG3 Large ribosomal subunit protein bL33C Sorangium cellulosum (strain So ce56)
B4SNM9 3.81e-19 74 63 0 52 3 rpmG Large ribosomal subunit protein bL33 Stenotrophomonas maltophilia (strain R551-3)
Q7VRK2 4.8e-19 74 64 0 53 3 rpmG Large ribosomal subunit protein bL33 Blochmanniella floridana
Q8D2F0 1.16e-18 73 63 0 55 3 rpmG Large ribosomal subunit protein bL33 Wigglesworthia glossinidia brevipalpis
B8IN36 1.51e-18 73 65 0 55 3 rpmG Large ribosomal subunit protein bL33 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q058B9 2.34e-18 72 61 0 54 3 rpmG Large ribosomal subunit protein bL33 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
B0UFA1 3.25e-18 72 63 0 55 3 rpmG Large ribosomal subunit protein bL33 Methylobacterium sp. (strain 4-46)
B1ZHG7 4.01e-18 72 63 0 55 3 rpmG Large ribosomal subunit protein bL33 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A9W3L4 4.01e-18 72 63 0 55 3 rpmG Large ribosomal subunit protein bL33 Methylorubrum extorquens (strain PA1)
B7KWY7 4.01e-18 72 63 0 55 3 rpmG Large ribosomal subunit protein bL33 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q168J2 4.57e-18 72 67 0 55 3 rpmG Large ribosomal subunit protein bL33 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B1LUW6 4.67e-18 72 63 0 55 3 rpmG Large ribosomal subunit protein bL33 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q5LP83 5.39e-18 72 65 0 55 3 rpmG Large ribosomal subunit protein bL33 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B5ENA6 8.14e-18 71 80 0 51 3 rpmG Large ribosomal subunit protein bL33 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
A1BA12 8.74e-18 71 65 0 55 3 rpmG Large ribosomal subunit protein bL33 Paracoccus denitrificans (strain Pd 1222)
Q491X1 9.13e-18 71 64 0 53 3 rpmG Large ribosomal subunit protein bL33 Blochmanniella pennsylvanica (strain BPEN)
Q28T20 1.16e-17 71 65 0 55 3 rpmG Large ribosomal subunit protein bL33 Jannaschia sp. (strain CCS1)
Q1GFB8 1.71e-17 70 63 0 55 3 rpmG Large ribosomal subunit protein bL33 Ruegeria sp. (strain TM1040)
Q0AQ67 1.71e-17 70 65 0 55 3 rpmG Large ribosomal subunit protein bL33 Maricaulis maris (strain MCS10)
A5VA19 5.91e-17 69 65 0 55 3 rpmG Large ribosomal subunit protein bL33 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A9HJ69 6.24e-17 69 61 0 55 3 rpmG Large ribosomal subunit protein bL33 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
C3MA88 9.26e-17 68 61 0 55 3 rpmG Large ribosomal subunit protein bL33 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q135H6 9.57e-17 68 61 0 55 3 rpmG Large ribosomal subunit protein bL33 Rhodopseudomonas palustris (strain BisB5)
B8EMP5 1.01e-16 68 63 0 55 3 rpmG Large ribosomal subunit protein bL33 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A6U802 1.25e-16 68 61 0 55 3 rpmG Large ribosomal subunit protein bL33 Sinorhizobium medicae (strain WSM419)
B2IBG2 1.45e-16 68 63 0 55 3 rpmG Large ribosomal subunit protein bL33 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B3Q9Y7 1.57e-16 68 61 0 55 3 rpmG Large ribosomal subunit protein bL33 Rhodopseudomonas palustris (strain TIE-1)
Q6N554 1.57e-16 68 61 0 55 1 rpmG Large ribosomal subunit protein bL33 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q92QM4 1.77e-16 68 60 0 55 3 rpmG Large ribosomal subunit protein bL33 Rhizobium meliloti (strain 1021)
Q31EB4 2.08e-16 67 64 1 51 3 rpmG Large ribosomal subunit protein bL33 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q5NQY1 2.49e-16 67 61 0 55 3 rpmG Large ribosomal subunit protein bL33 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q89K02 3.13e-16 67 60 0 55 3 rpmG Large ribosomal subunit protein bL33 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A4YWH5 3.74e-16 67 60 0 55 3 rpmG Large ribosomal subunit protein bL33 Bradyrhizobium sp. (strain ORS 278)
A5EKS0 3.74e-16 67 60 0 55 3 rpmG Large ribosomal subunit protein bL33 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q0BU03 3.86e-16 67 61 0 55 3 rpmG Large ribosomal subunit protein bL33 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
A8LJ19 4.21e-16 67 61 0 55 3 rpmG Large ribosomal subunit protein bL33 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q1CY77 4.5e-16 67 62 0 53 3 rpmG2 Large ribosomal subunit protein bL33B Myxococcus xanthus (strain DK1622)
Q2IXE1 4.6e-16 67 60 0 55 3 rpmG Large ribosomal subunit protein bL33 Rhodopseudomonas palustris (strain HaA2)
Q2W1A2 9.09e-16 66 61 0 55 3 rpmG Large ribosomal subunit protein bL33 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q3SSP7 9.39e-16 66 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q1QKL6 9.39e-16 66 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q07L69 1.06e-15 66 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Rhodopseudomonas palustris (strain BisA53)
B9JVH6 1.08e-15 66 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q8UFU8 1.16e-15 66 60 0 55 3 rpmG Large ribosomal subunit protein bL33 Agrobacterium fabrum (strain C58 / ATCC 33970)
B9KM57 1.24e-15 66 60 0 55 3 rpmG Large ribosomal subunit protein bL33 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A4WQB2 1.24e-15 66 60 0 55 3 rpmG Large ribosomal subunit protein bL33 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q3J5A0 1.24e-15 66 60 0 55 3 rpmG Large ribosomal subunit protein bL33 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PH34 1.24e-15 66 60 0 55 3 rpmG Large ribosomal subunit protein bL33 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q1GNX0 2.14e-15 65 61 0 55 3 rpmG Large ribosomal subunit protein bL33 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A7IM41 2.21e-15 65 60 0 55 3 rpmG Large ribosomal subunit protein bL33 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q215Z7 2.61e-15 65 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Rhodopseudomonas palustris (strain BisB18)
B9JDL2 2.79e-15 65 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q1MII4 2.79e-15 65 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A7HWZ1 2.85e-15 65 60 0 55 3 rpmG Large ribosomal subunit protein bL33 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A9IU26 2.85e-15 65 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q6G3F9 2.85e-15 65 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q2N758 3.18e-15 65 60 0 55 3 rpmG Large ribosomal subunit protein bL33 Erythrobacter litoralis (strain HTCC2594)
Q2G3F0 3.36e-15 65 60 0 55 3 rpmG Large ribosomal subunit protein bL33 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q98LW4 3.55e-15 65 56 0 55 3 rpmG Large ribosomal subunit protein bL33 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A1UT31 4.37e-15 64 56 0 55 3 rpmG Large ribosomal subunit protein bL33 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q2K9Q3 4.62e-15 64 56 0 55 3 rpmG Large ribosomal subunit protein bL33 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PW29 4.62e-15 64 56 0 55 3 rpmG Large ribosomal subunit protein bL33 Rhizobium etli (strain CIAT 652)
P66216 5.69e-15 64 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Brucella suis biovar 1 (strain 1330)
A9WYS8 5.69e-15 64 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU1 5.69e-15 64 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P66215 5.69e-15 64 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RLD0 5.69e-15 64 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Brucella melitensis biotype 2 (strain ATCC 23457)
A9MBP9 5.69e-15 64 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q578A8 5.69e-15 64 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Brucella abortus biovar 1 (strain 9-941)
A6X578 5.69e-15 64 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q2YKM8 5.69e-15 64 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Brucella abortus (strain 2308)
B2SB47 5.69e-15 64 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Brucella abortus (strain S19)
Q11IM9 6.14e-15 64 56 0 55 3 rpmG Large ribosomal subunit protein bL33 Chelativorans sp. (strain BNC1)
Q125U1 7.48e-15 63 70 0 55 3 rpmG Large ribosomal subunit protein bL33 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A8I2D3 9.22e-15 63 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q5FNN7 1.12e-14 63 58 0 48 3 rpmG Large ribosomal subunit protein bL33 Gluconobacter oxydans (strain 621H)
Q6FZR9 1.35e-14 63 56 0 55 3 rpmG Large ribosomal subunit protein bL33 Bartonella quintana (strain Toulouse)
A5FUI6 1.48e-14 63 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Acidiphilium cryptum (strain JF-5)
B6IN38 1.63e-14 63 61 0 55 3 rpmG Large ribosomal subunit protein bL33 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q9RSS4 2.82e-14 62 56 1 55 1 rpmG Large ribosomal subunit protein bL33 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
B8G845 4.23e-14 62 56 1 51 3 rpmG Large ribosomal subunit protein bL33 Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q6A5U7 4.34e-14 62 55 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Cutibacterium acnes (strain DSM 16379 / KPA171202)
B0T0I3 4.53e-14 62 58 0 55 3 rpmG Large ribosomal subunit protein bL33 Caulobacter sp. (strain K31)
B9LIX9 4.57e-14 62 56 1 51 3 rpmG Large ribosomal subunit protein bL33 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WE59 4.57e-14 62 56 1 51 3 rpmG Large ribosomal subunit protein bL33 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q1J0N7 9.55e-14 61 54 1 55 3 rpmG Large ribosomal subunit protein bL33 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
B8GZL9 9.55e-14 61 56 0 55 3 rpmG Large ribosomal subunit protein bL33 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I8 9.55e-14 61 56 0 55 3 rpmG Large ribosomal subunit protein bL33 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B4R955 1.14e-13 61 56 0 55 3 rpmG Large ribosomal subunit protein bL33 Phenylobacterium zucineum (strain HLK1)
Q8FR25 1.67e-13 60 53 1 54 3 rpmG Large ribosomal subunit protein bL33 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
C3PF14 1.67e-13 60 53 1 54 3 rpmG Large ribosomal subunit protein bL33 Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
A4F7S0 2.08e-13 60 46 0 52 3 rpmG1 Large ribosomal subunit protein bL33A Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q6NIC7 2.3e-13 60 53 1 54 3 rpmG Large ribosomal subunit protein bL33 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
C1D0S9 2.51e-13 60 52 1 55 3 rpmG Large ribosomal subunit protein bL33 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q5PBA7 3.2e-13 60 53 0 47 3 rpmG Large ribosomal subunit protein bL33 Anaplasma marginale (strain St. Maries)
B9KI16 3.2e-13 60 53 0 47 3 rpmG Large ribosomal subunit protein bL33 Anaplasma marginale (strain Florida)
Q0BZW6 3.34e-13 60 56 0 55 3 rpmG Large ribosomal subunit protein bL33 Hyphomonas neptunium (strain ATCC 15444)
B2GG85 4.07e-13 59 54 0 51 3 rpmG Large ribosomal subunit protein bL33 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Q2GJF3 4.96e-13 59 49 0 53 3 rpmG Large ribosomal subunit protein bL33 Anaplasma phagocytophilum (strain HZ)
Q5WZ63 5.17e-13 59 56 0 48 3 rpmG Large ribosomal subunit protein bL33 Legionella pneumophila (strain Lens)
Q5ZY94 5.17e-13 59 56 0 48 3 rpmG Large ribosomal subunit protein bL33 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHB7 5.17e-13 59 56 0 48 3 rpmG Large ribosomal subunit protein bL33 Legionella pneumophila (strain Corby)
Q5X7R2 5.17e-13 59 56 0 48 3 rpmG Large ribosomal subunit protein bL33 Legionella pneumophila (strain Paris)
Q6ABY5 5.18e-13 59 52 1 55 3 rpmG Large ribosomal subunit protein bL33 Leifsonia xyli subsp. xyli (strain CTCB07)
A5CV83 5.18e-13 59 52 1 55 3 rpmG Large ribosomal subunit protein bL33 Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
C4LHF2 6.88e-13 58 51 1 54 3 rpmG Large ribosomal subunit protein bL33 Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
Q4JTZ8 6.88e-13 58 51 1 54 3 rpmG Large ribosomal subunit protein bL33 Corynebacterium jeikeium (strain K411)
Q2GEE6 1.06e-12 58 54 0 46 3 rpmG Large ribosomal subunit protein bL33 Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
A5CCZ7 1.45e-12 58 57 0 47 3 rpmG Large ribosomal subunit protein bL33 Orientia tsutsugamushi (strain Boryong)
B1VFG2 1.47e-12 58 51 1 54 3 rpmG Large ribosomal subunit protein bL33 Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
A3Q6V2 1.55e-12 58 50 1 54 3 rpmG2 Large ribosomal subunit protein bL33B Mycobacterium sp. (strain JLS)
C5C6R2 1.83e-12 58 50 0 51 3 rpmG Large ribosomal subunit protein bL33 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
A4X8U5 1.89e-12 58 44 0 49 3 rpmG1 Large ribosomal subunit protein bL33A Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q8NS16 2.18e-12 57 51 1 54 3 rpmG Large ribosomal subunit protein bL33 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QCL0 2.18e-12 57 51 1 54 3 rpmG Large ribosomal subunit protein bL33 Corynebacterium glutamicum (strain R)
A9WTS8 2.28e-12 57 49 0 51 3 rpmG Large ribosomal subunit protein bL33 Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
A5US14 2.8e-12 57 50 1 51 3 rpmG Large ribosomal subunit protein bL33 Roseiflexus sp. (strain RS-1)
B0RDL0 2.93e-12 57 50 1 55 3 rpmG Large ribosomal subunit protein bL33 Clavibacter sepedonicus
Q9ZC89 3.07e-12 57 55 0 47 3 rpmG Large ribosomal subunit protein bL33 Rickettsia prowazekii (strain Madrid E)
A0PWL9 3.13e-12 57 48 1 54 3 rpmG2 Large ribosomal subunit protein bL33B Mycobacterium ulcerans (strain Agy99)
B2HKQ3 3.13e-12 57 48 1 54 3 rpmG1 Large ribosomal subunit protein bL33A Mycobacterium marinum (strain ATCC BAA-535 / M)
A1TGF9 3.65e-12 57 46 1 54 3 rpmG2 Large ribosomal subunit protein bL33B Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q73TE9 3.73e-12 57 46 1 54 3 rpmG1 Large ribosomal subunit protein bL33A Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QM60 3.85e-12 57 48 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Mycobacterium avium (strain 104)
Q0S4Z0 3.99e-12 57 55 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Rhodococcus jostii (strain RHA1)
B1MFN2 4.07e-12 57 48 1 54 3 rpmG1 Large ribosomal subunit protein bL33A Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A7NP88 5.47e-12 57 49 1 51 3 rpmG Large ribosomal subunit protein bL33 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q1B2Q0 5.72e-12 56 50 1 54 3 rpmG2 Large ribosomal subunit protein bL33B Mycobacterium sp. (strain MCS)
A1UME8 5.72e-12 56 50 1 54 3 rpmG2 Large ribosomal subunit protein bL33B Mycobacterium sp. (strain KMS)
A8M6L0 5.92e-12 56 42 0 49 3 rpmG1 Large ribosomal subunit protein bL33A Salinispora arenicola (strain CNS-205)
A4T600 8.4e-12 56 46 0 49 3 rpmG1 Large ribosomal subunit protein bL33A Mycolicibacterium gilvum (strain PYR-GCK)
Q54YX7 9.91e-12 56 54 0 46 3 mrpl33 Large ribosomal subunit protein bL33m Dictyostelium discoideum
A8GU57 1.54e-11 55 53 0 47 3 rpmG Large ribosomal subunit protein bL33 Rickettsia rickettsii (strain Sheila Smith)
B0BVP6 1.54e-11 55 53 0 47 3 rpmG Large ribosomal subunit protein bL33 Rickettsia rickettsii (strain Iowa)
A8F2Z7 1.54e-11 55 53 0 47 3 rpmG Large ribosomal subunit protein bL33 Rickettsia massiliae (strain Mtu5)
Q4UJQ2 1.54e-11 55 53 0 47 3 rpmG Large ribosomal subunit protein bL33 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q92FW7 1.54e-11 55 53 0 47 3 rpmG Large ribosomal subunit protein bL33 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A8F0A3 1.54e-11 55 53 0 47 3 rpmG Large ribosomal subunit protein bL33 Rickettsia canadensis (strain McKiel)
A8GQA8 1.54e-11 55 53 0 47 3 rpmG Large ribosomal subunit protein bL33 Rickettsia akari (strain Hartford)
C3PM21 1.54e-11 55 53 0 47 3 rpmG Large ribosomal subunit protein bL33 Rickettsia africae (strain ESF-5)
A0R551 1.71e-11 55 44 1 54 1 rpmG2 Large ribosomal subunit protein bL33B Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A9NEJ5 1.75e-11 55 55 0 49 3 rpmG1 Large ribosomal subunit protein bL33A Acholeplasma laidlawii (strain PG-8A)
B1VN49 1.91e-11 55 45 0 48 3 rpmG3 Large ribosomal subunit protein bL33C Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q5YPR3 2.05e-11 55 46 0 49 3 rpmG1 Large ribosomal subunit protein bL33A Nocardia farcinica (strain IFM 10152)
Q68VN5 2.23e-11 55 53 0 47 3 rpmG Large ribosomal subunit protein bL33 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
B1VRF7 2.28e-11 55 44 1 54 3 rpmG1 Large ribosomal subunit protein bL33A Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q1RGQ4 2.31e-11 55 53 0 47 3 rpmG Large ribosomal subunit protein bL33 Rickettsia bellii (strain RML369-C)
A8GY80 2.31e-11 55 53 0 47 3 rpmG Large ribosomal subunit protein bL33 Rickettsia bellii (strain OSU 85-389)
A1RB23 2.57e-11 55 47 0 51 3 rpmG Large ribosomal subunit protein bL33 Paenarthrobacter aurescens (strain TC1)
A0K1X5 2.6e-11 55 47 0 51 3 rpmG Large ribosomal subunit protein bL33 Arthrobacter sp. (strain FB24)
A6W4N7 3.1e-11 55 42 0 52 3 rpmG2 Large ribosomal subunit protein bL33B Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q5HBV6 5.86e-11 54 46 0 47 3 rpmG Large ribosomal subunit protein bL33 Ehrlichia ruminantium (strain Welgevonden)
Q5FFJ4 5.86e-11 54 46 0 47 3 rpmG Large ribosomal subunit protein bL33 Ehrlichia ruminantium (strain Gardel)
B8H775 7.71e-11 53 45 0 51 3 rpmG Large ribosomal subunit protein bL33 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A6W4H8 8.79e-11 53 45 1 55 3 rpmG1 Large ribosomal subunit protein bL33A Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
A1QZI4 8.83e-11 53 51 0 54 3 rpmG Large ribosomal subunit protein bL33 Borrelia turicatae (strain 91E135)
B2S099 8.83e-11 53 51 0 54 3 rpmG Large ribosomal subunit protein bL33 Borrelia hermsii (strain HS1 / DAH)
Q82EH2 9.28e-11 53 42 1 54 3 rpmG1 Large ribosomal subunit protein bL33A Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8RHH9 1.28e-10 53 51 0 49 3 rpmG Large ribosomal subunit protein bL33 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q7VJ75 2.09e-10 52 52 0 55 3 rpmG Large ribosomal subunit protein bL33 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q3YSN4 2.81e-10 52 47 0 53 3 rpmG Large ribosomal subunit protein bL33 Ehrlichia canis (strain Jake)
Q2RPE5 2.88e-10 52 49 0 55 3 rpmG Large ribosomal subunit protein bL33 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q83GW7 3.62e-10 52 39 0 51 3 rpmG Large ribosomal subunit protein bL33 Tropheryma whipplei (strain Twist)
Q83IB5 3.62e-10 52 39 0 51 3 rpmG Large ribosomal subunit protein bL33 Tropheryma whipplei (strain TW08/27)
B3CRY6 4.41e-10 52 55 0 43 3 rpmG Large ribosomal subunit protein bL33 Orientia tsutsugamushi (strain Ikeda)
Q9X8K7 8.51e-10 51 42 1 54 3 rpmG1 Large ribosomal subunit protein bL33A Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q661M2 1.09e-09 51 50 0 54 3 rpmG Large ribosomal subunit protein bL33 Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
B7J1W7 1.09e-09 51 50 0 54 3 rpmG Large ribosomal subunit protein bL33 Borreliella burgdorferi (strain ZS7)
O51357 1.09e-09 51 50 0 54 1 rpmG Large ribosomal subunit protein bL33 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q0SNB1 1.09e-09 51 50 0 54 3 rpmG Large ribosomal subunit protein bL33 Borreliella afzelii (strain PKo)
Q5GSD9 1.35e-09 51 43 1 57 3 rpmG Large ribosomal subunit protein bL33 Wolbachia sp. subsp. Brugia malayi (strain TRS)
P35871 1.44e-09 50 44 0 54 1 rpmG Large ribosomal subunit protein bL33 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72GW3 1.44e-09 50 44 0 54 1 rpmG Large ribosomal subunit protein bL33 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B3CNB7 1.96e-09 50 51 0 39 3 rpmG Large ribosomal subunit protein bL33 Wolbachia pipientis subsp. Culex pipiens (strain wPip)
B1YLB5 2.24e-09 50 46 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B5RRK4 3.51e-09 49 53 0 47 3 rpmG Large ribosomal subunit protein bL33 Borrelia recurrentis (strain A1)
B5RLV6 3.51e-09 49 53 0 47 3 rpmG Large ribosomal subunit protein bL33 Borrelia duttonii (strain Ly)
Q73GL5 3.69e-09 50 42 1 57 3 rpmG Large ribosomal subunit protein bL33 Wolbachia pipientis wMel
Q822Z9 3.87e-09 49 52 1 53 3 rpmG Large ribosomal subunit protein bL33 Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q5L5W6 3.87e-09 49 52 1 53 3 rpmG Large ribosomal subunit protein bL33 Chlamydia abortus (strain DSM 27085 / S26/3)
A9NGI6 4.13e-09 49 46 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Acholeplasma laidlawii (strain PG-8A)
Q65HN7 4.18e-09 49 44 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
O84152 5.09e-09 49 52 1 53 3 rpmG Large ribosomal subunit protein bL33 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KML9 5.09e-09 49 52 1 53 3 rpmG Large ribosomal subunit protein bL33 Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B2S2I1 6.34e-09 49 43 2 58 3 rpmG Large ribosomal subunit protein bL33 Treponema pallidum subsp. pallidum (strain SS14)
O83262 6.34e-09 49 43 2 58 3 rpmG Large ribosomal subunit protein bL33 Treponema pallidum (strain Nichols)
Q9Z8T4 6.99e-09 48 50 1 53 3 rpmG Large ribosomal subunit protein bL33 Chlamydia pneumoniae
Q9PKN7 7.22e-09 48 52 1 53 3 rpmG Large ribosomal subunit protein bL33 Chlamydia muridarum (strain MoPn / Nigg)
Q5WH99 1.2e-08 48 40 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Shouchella clausii (strain KSM-K16)
A8FI96 1.34e-08 48 44 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Bacillus pumilus (strain SAFR-032)
Q8EQ04 1.56e-08 48 42 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B0BBD7 2.55e-08 47 50 1 53 3 rpmG Large ribosomal subunit protein bL33 Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B9Q8 2.55e-08 47 50 1 53 3 rpmG Large ribosomal subunit protein bL33 Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
P59629 2.79e-08 47 40 0 49 3 rpmG4 Large ribosomal subunit protein bL33D Enterococcus faecalis (strain ATCC 700802 / V583)
A7Z6E9 2.95e-08 47 42 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
C0QWW9 3.55e-08 47 47 0 53 3 rpmG Large ribosomal subunit protein bL33 Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q1D7V0 4.36e-08 47 48 0 54 3 rpmG1 Large ribosomal subunit protein bL33A Myxococcus xanthus (strain DK1622)
O67756 5.75e-08 46 45 0 48 3 rpmG Large ribosomal subunit protein bL33 Aquifex aeolicus (strain VF5)
Q1XDN2 5.82e-08 47 38 1 62 3 rpl33 Large ribosomal subunit protein bL33c Neopyropia yezoensis
Q4RGM4 6.22e-08 47 44 1 45 3 mrpl33 Large ribosomal subunit protein bL33m Tetraodon nigroviridis
A4XLK5 7.97e-08 46 42 0 52 3 rpmG Large ribosomal subunit protein bL33 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q6A6J5 8.61e-08 46 40 0 49 1 rpmG1 Large ribosomal subunit protein bL33A Cutibacterium acnes (strain DSM 16379 / KPA171202)
A8Z216 8.71e-08 46 40 0 50 3 rpmG2 Large ribosomal subunit protein bL33B Staphylococcus aureus (strain USA300 / TCH1516)
Q2YXT1 8.71e-08 46 40 0 50 3 rpmG2 Large ribosomal subunit protein bL33B Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FH98 8.71e-08 46 40 0 50 3 rpmG1 Large ribosomal subunit protein bL33A Staphylococcus aureus (strain USA300)
A4VT05 1.01e-07 45 42 0 49 3 rpmG Large ribosomal subunit protein bL33 Streptococcus suis (strain 05ZYH33)
A4VZ90 1.01e-07 45 42 0 49 3 rpmG Large ribosomal subunit protein bL33 Streptococcus suis (strain 98HAH33)
Q03IA9 1.01e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M277 1.01e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXM5 1.01e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus thermophilus (strain CNRZ 1066)
A9G209 1.2e-07 45 50 0 50 3 rpmG2 Large ribosomal subunit protein bL33B Sorangium cellulosum (strain So ce56)
Q97EG2 1.21e-07 45 42 0 49 3 rpmG Large ribosomal subunit protein bL33 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8CSP9 1.23e-07 45 42 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPK7 1.23e-07 45 42 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B9MJX4 1.26e-07 45 42 0 52 3 rpmG Large ribosomal subunit protein bL33 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A8EW01 1.28e-07 45 45 0 55 3 rpmG Large ribosomal subunit protein bL33 Aliarcobacter butzleri (strain RM4018)
B2IN61 1.31e-07 45 42 0 49 3 rpmG Large ribosomal subunit protein bL33 Streptococcus pneumoniae (strain CGSP14)
B5E3E3 1.31e-07 45 42 0 49 3 rpmG Large ribosomal subunit protein bL33 Streptococcus pneumoniae serotype 19F (strain G54)
Q04I36 1.31e-07 45 42 0 49 3 rpmG Large ribosomal subunit protein bL33 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A8AZV4 1.31e-07 45 42 0 49 3 rpmG Large ribosomal subunit protein bL33 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B4U0K8 1.31e-07 45 42 0 49 3 rpmG Large ribosomal subunit protein bL33 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q3JYL4 1.31e-07 45 42 0 49 3 rpmG Large ribosomal subunit protein bL33 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
P61361 1.31e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P61360 1.31e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q1JJF9 1.31e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J9B1 1.31e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus pyogenes serotype M12 (strain MGAS2096)
P61363 1.31e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P61362 1.31e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus agalactiae serotype III (strain NEM316)
B1I9V1 1.31e-07 45 42 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Streptococcus pneumoniae (strain Hungary19A-6)
P0A489 1.86e-07 45 46 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Lactococcus lactis subsp. lactis (strain IL1403)
P0A490 1.86e-07 45 46 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Lactococcus lactis subsp. cremoris
Q033B9 1.86e-07 45 46 0 49 3 rpmG1 Large ribosomal subunit protein bL33A Lactococcus lactis subsp. cremoris (strain SK11)
A2RHG9 1.86e-07 45 46 0 49 3 rpmG1 Large ribosomal subunit protein bL33A Lactococcus lactis subsp. cremoris (strain MG1363)
Q93S00 2.05e-07 45 41 0 48 3 rpmG3 Large ribosomal subunit protein bL33C Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q4L644 2.17e-07 45 40 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Staphylococcus haemolyticus (strain JCSC1435)
P66232 2.17e-07 45 40 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Staphylococcus aureus (strain MW2)
Q6G9M3 2.17e-07 45 40 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Staphylococcus aureus (strain MSSA476)
Q6GH71 2.17e-07 45 40 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Staphylococcus aureus (strain MRSA252)
P66231 2.17e-07 45 40 0 49 1 rpmG2 Large ribosomal subunit protein bL33B Staphylococcus aureus (strain N315)
P66230 2.17e-07 45 40 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QGN7 2.17e-07 45 40 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Staphylococcus aureus (strain Newman)
Q5HG85 2.17e-07 45 40 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Staphylococcus aureus (strain COL)
A5ISL7 2.17e-07 45 40 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Staphylococcus aureus (strain JH9)
A6U1F5 2.17e-07 45 40 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Staphylococcus aureus (strain JH1)
Q2FYU6 2.17e-07 45 40 0 49 1 rpmG1 Large ribosomal subunit protein bL33A Staphylococcus aureus (strain NCTC 8325 / PS 47)
A7X1Y9 2.17e-07 45 40 0 49 3 rpmG1 Large ribosomal subunit protein bL33A Staphylococcus aureus (strain Mu3 / ATCC 700698)
P66237 2.53e-07 45 42 0 49 3 rpmG Large ribosomal subunit protein bL33 Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DE45 2.53e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48QS5 2.53e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RGY3 2.53e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J478 2.53e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEG0 2.53e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q5X9E3 2.53e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE44 2.53e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66235 2.53e-07 45 42 0 49 3 rpmG3 Large ribosomal subunit protein bL33C Streptococcus pyogenes serotype M1
Q8KU55 2.7e-07 44 40 0 49 3 rpmG1 Large ribosomal subunit protein bL33A Enterococcus faecalis (strain ATCC 700802 / V583)
A6MVX6 3.24e-07 44 43 1 53 3 rpl33 Large ribosomal subunit protein bL33c Rhodomonas salina
Q49XD0 3.83e-07 44 40 0 49 3 rpmG2 Large ribosomal subunit protein bL33B Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A0LRK1 4.36e-07 44 40 0 50 3 rpmG Large ribosomal subunit protein bL33 Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
P66217 4.51e-07 44 50 0 48 3 rpmG Large ribosomal subunit protein bL33 Helicobacter pylori (strain ATCC 700392 / 26695)
B2UUW7 4.51e-07 44 50 0 48 3 rpmG Large ribosomal subunit protein bL33 Helicobacter pylori (strain Shi470)
P66218 4.51e-07 44 50 0 48 3 rpmG Large ribosomal subunit protein bL33 Helicobacter pylori (strain J99 / ATCC 700824)
Q1CS61 4.51e-07 44 50 0 48 3 rpmG Large ribosomal subunit protein bL33 Helicobacter pylori (strain HPAG1)
B3DPY6 4.97e-07 44 41 1 55 3 rpmG Large ribosomal subunit protein bL33 Bifidobacterium longum (strain DJO10A)
B3W8W8 5.04e-07 44 40 0 49 3 rpmG Large ribosomal subunit protein bL33 Lacticaseibacillus casei (strain BL23)
Q037L6 5.04e-07 44 40 0 49 3 rpmG1 Large ribosomal subunit protein bL33A Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q47LH2 5.37e-07 44 36 0 52 3 rpmG Large ribosomal subunit protein bL33 Thermobifida fusca (strain YX)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_16250
Feature type CDS
Gene rpmG
Product 50S ribosomal protein L33
Location 38096 - 38263 (strand: 1)
Length 168 (nucleotides) / 55 (amino acids)
In genomic island -

Contig

Accession contig_23
Length 63965 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2195
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00471 Ribosomal protein L33

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0267 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L33

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02913 large subunit ribosomal protein L33 Ribosome -

Protein Sequence

MAKGIREKIKLVSSEGTGHFYTTTKNKRTMPEKLEMKKFDPVVRKHVMYKEAKIK

Flanking regions ( +/- flanking 50bp)

GTTTTAGCTGATTTACGTACCCGCGGTGAGAAGTACTAAGGAGCTGAAAAATGGCTAAAGGTATTCGCGAAAAGATCAAACTGGTTTCTTCTGAAGGTACAGGTCACTTCTATACCACTACGAAGAACAAACGTACTATGCCTGAAAAACTGGAAATGAAAAAATTCGATCCGGTTGTTCGTAAGCATGTAATGTACAAAGAAGCAAAAATTAAGTAATTTCTGCTTCCTGATTGAAAAAACCCGGCCTCGGCCGGGTTTTTTATTGC