Homologs in group_1969

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_15570 EHELCC_15570 100.0 Morganella morganii S2 tmaR PTS system regulator TmaR
NLDBIP_16100 NLDBIP_16100 100.0 Morganella morganii S4 tmaR PTS system regulator TmaR
LHKJJB_15740 LHKJJB_15740 100.0 Morganella morganii S3 tmaR PTS system regulator TmaR
HKOGLL_14860 HKOGLL_14860 100.0 Morganella morganii S5 tmaR PTS system regulator TmaR
F4V73_RS07560 F4V73_RS07560 96.3 Morganella psychrotolerans tmaR PTS system regulator TmaR
PMI_RS04175 PMI_RS04175 86.1 Proteus mirabilis HI4320 tmaR PTS system regulator TmaR

Distribution of the homologs in the orthogroup group_1969

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1969

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4ETB9 7.87e-63 189 86 0 107 3 PMI0851 UPF0265 protein PMI0851 Proteus mirabilis (strain HI4320)
A1JTU7 2.44e-61 185 84 0 105 3 YE2755 UPF0265 protein YE2755 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q1C9P9 5.61e-61 184 83 0 105 3 YPA_0855 UPF0265 protein YPA_0855 Yersinia pestis bv. Antiqua (strain Antiqua)
B1JPU8 5.61e-61 184 83 0 105 3 YPK_2514 UPF0265 protein YPK_2514 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q1CGY2 5.61e-61 184 83 0 105 3 YPN_2420 UPF0265 protein YPN_2420 Yersinia pestis bv. Antiqua (strain Nepal516)
A7FJF8 5.61e-61 184 83 0 105 3 YpsIP31758_2417 UPF0265 protein YpsIP31758_2417 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2JZP2 5.61e-61 184 83 0 105 3 YPTS_1683 UPF0265 protein YPTS_1683 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q66C39 5.61e-61 184 83 0 105 3 YPTB1571 UPF0265 protein YPTB1571 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZFW5 5.61e-61 184 83 0 105 3 YPO1560 UPF0265 protein YPO1560/y2607/YP_1448 Yersinia pestis
A4TKJ3 5.61e-61 184 83 0 105 3 YPDSF_1416 UPF0265 protein YPDSF_1416 Yersinia pestis (strain Pestoides F)
Q7N376 6.33e-61 184 84 0 105 3 plu2843 UPF0265 protein plu2843 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GGR6 1.4e-60 183 83 0 105 3 Spro_3208 UPF0265 protein Spro_3208 Serratia proteamaculans (strain 568)
Q6D434 1.44e-59 181 83 0 105 3 ECA2560 UPF0265 protein ECA2560 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DF99 3.29e-59 179 82 0 105 3 PC1_1767 UPF0265 protein PC1_1767 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q2NTW6 1.79e-55 171 82 0 100 3 SG1134 UPF0265 protein SG1134 Sodalis glossinidius (strain morsitans)
Q8KR41 9e-55 169 79 0 103 3 yeeX UPF0265 protein YeeX Escherichia fergusonii
P0A8M9 1.72e-54 168 78 0 103 3 yeeX UPF0265 protein YeeX Shigella flexneri
B2TYH5 1.72e-54 168 78 0 103 3 yeeX UPF0265 protein YeeX Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LP36 1.72e-54 168 78 0 103 3 yeeX UPF0265 protein YeeX Escherichia coli (strain SMS-3-5 / SECEC)
B6I833 1.72e-54 168 78 0 103 3 yeeX UPF0265 protein YeeX Escherichia coli (strain SE11)
P0A8M6 1.72e-54 168 78 0 103 1 yeeX UPF0265 protein YeeX Escherichia coli (strain K12)
B1IZQ6 1.72e-54 168 78 0 103 3 yeeX UPF0265 protein YeeX Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8M7 1.72e-54 168 78 0 103 3 yeeX UPF0265 protein YeeX Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TG79 1.72e-54 168 78 0 103 3 yeeX UPF0265 protein YeeX Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A1N0 1.72e-54 168 78 0 103 3 yeeX UPF0265 protein YeeX Escherichia coli O9:H4 (strain HS)
C4ZQR6 1.72e-54 168 78 0 103 3 yeeX UPF0265 protein YeeX Escherichia coli (strain K12 / MC4100 / BW2952)
B5YTE1 1.72e-54 168 78 0 103 3 yeeX UPF0265 protein YeeX Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8M8 1.72e-54 168 78 0 103 3 yeeX UPF0265 protein YeeX Escherichia coli O157:H7
B7UT45 1.72e-54 168 78 0 103 3 yeeX UPF0265 protein YeeX Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZNH9 1.72e-54 168 78 0 103 3 yeeX UPF0265 protein YeeX Escherichia coli O139:H28 (strain E24377A / ETEC)
C5BD23 1.76e-54 168 78 0 103 3 NT01EI_1321 UPF0265 protein NT01EI_1321 Edwardsiella ictaluri (strain 93-146)
P67605 2.09e-54 167 79 0 102 3 yeeX UPF0265 protein YeeX Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67606 2.09e-54 167 79 0 102 3 yeeX UPF0265 protein YeeX Salmonella typhi
B4TMJ8 2.09e-54 167 79 0 102 3 yeeX UPF0265 protein YeeX Salmonella schwarzengrund (strain CVM19633)
B5BFD0 2.09e-54 167 79 0 102 3 yeeX UPF0265 protein YeeX Salmonella paratyphi A (strain AKU_12601)
C0Q1L6 2.09e-54 167 79 0 102 3 yeeX UPF0265 protein YeeX Salmonella paratyphi C (strain RKS4594)
A9MSK6 2.09e-54 167 79 0 102 3 yeeX UPF0265 protein YeeX Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PDQ9 2.09e-54 167 79 0 102 3 yeeX UPF0265 protein YeeX Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SX27 2.09e-54 167 79 0 102 3 yeeX UPF0265 protein YeeX Salmonella newport (strain SL254)
B4T911 2.09e-54 167 79 0 102 3 yeeX UPF0265 protein YeeX Salmonella heidelberg (strain SL476)
B5RBP9 2.09e-54 167 79 0 102 3 yeeX UPF0265 protein YeeX Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZJ9 2.09e-54 167 79 0 102 3 yeeX UPF0265 protein YeeX Salmonella enteritidis PT4 (strain P125109)
B5FM27 2.09e-54 167 79 0 102 3 yeeX UPF0265 protein YeeX Salmonella dublin (strain CT_02021853)
Q57MT7 2.09e-54 167 79 0 102 3 yeeX UPF0265 protein YeeX Salmonella choleraesuis (strain SC-B67)
A9MLN4 2.09e-54 167 79 0 102 3 yeeX UPF0265 protein YeeX Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5EX25 2.09e-54 167 79 0 102 3 yeeX UPF0265 protein YeeX Salmonella agona (strain SL483)
B2VFM6 6.76e-54 166 80 1 105 3 ETA_13650 UPF0265 protein ETA_13650 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4WC14 9.83e-54 166 78 0 102 3 Ent638_2575 UPF0265 protein Ent638_2575 Enterobacter sp. (strain 638)
A7MJN1 1.04e-53 166 78 1 105 3 ESA_01212 UPF0265 protein ESA_01212 Cronobacter sakazakii (strain ATCC BAA-894)
B7LTX6 1.35e-53 166 77 0 103 3 yeeX UPF0265 protein YeeX Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A6TBB2 1.75e-53 165 78 0 102 3 KPN78578_24220 UPF0265 protein KPN78578_24220 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XPI0 1.75e-53 165 78 0 102 3 KPK_1722 UPF0265 protein KPK_1722 Klebsiella pneumoniae (strain 342)
A4SHW1 9.64e-49 153 70 0 105 3 ASA_0299 UPF0265 protein ASA_0299 Aeromonas salmonicida (strain A449)
Q492K6 5.25e-45 144 74 0 99 3 BPEN_475 UPF0265 protein BPEN_475 Blochmanniella pennsylvanica (strain BPEN)
Q65S81 2.76e-43 140 68 0 100 3 MS1572 UPF0265 protein MS1572 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7VQX3 3.84e-41 134 71 0 95 3 Bfl460 UPF0265 protein Bfl460 Blochmanniella floridana
Q7VLP5 1.58e-39 130 58 0 108 3 HD_1377 UPF0265 protein HD_1377 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B8F426 2.18e-39 129 62 0 98 3 HAPS_0398 UPF0265 protein HAPS_0398 Glaesserella parasuis serovar 5 (strain SH0165)
Q8K922 3.38e-39 129 64 0 99 3 BUsg_538 UPF0265 protein BUsg_538 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57621 5.34e-39 129 68 0 97 3 BU556 UPF0265 protein BU556 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D879 5.34e-39 129 68 0 97 3 BUAPTUC7_550 UPF0265 protein BUAPTUC7_550 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D9X7 5.34e-39 129 68 0 97 3 BUAP5A_549 UPF0265 protein BUAP5A_549 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B3GXE4 1.57e-38 127 60 0 100 3 APP7_0751 UPF0265 protein APP7_0751 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N073 1.63e-38 127 60 0 100 3 APL_0709 UPF0265 protein APL_0709 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BNZ0 1.63e-38 127 60 0 100 3 APJL_0708 UPF0265 protein APJL_0708 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A6VMU2 1.11e-37 125 62 1 103 3 Asuc_0921 UPF0265 protein Asuc_0921 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q9CMI8 1.03e-36 123 55 0 107 3 PM0836 UPF0265 protein PM0836 Pasteurella multocida (strain Pm70)
A1SY66 2.53e-35 119 68 0 91 3 Ping_2721 UPF0265 protein Ping_2721 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A5UIT6 7.13e-35 118 57 0 99 3 CGSHiGG_09540 UPF0265 protein CGSHiGG_09540 Haemophilus influenzae (strain PittGG)
A5UCU0 7.13e-35 118 57 0 99 3 CGSHiEE_06200 UPF0265 protein CGSHiEE_06200 Haemophilus influenzae (strain PittEE)
P44117 7.13e-35 118 57 0 99 1 HI_1168 UPF0265 protein HI_1168 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QLC9 1.23e-34 118 57 0 99 3 NTHI1336 UPF0265 protein NTHI1336 Haemophilus influenzae (strain 86-028NP)
A5EZT0 1.13e-32 112 61 0 95 3 VC0395_0679 UPF0265 protein VC0395_0679/VC395_A0572 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KLK2 1.13e-32 112 61 0 95 3 VC_A0741 UPF0265 protein VC_A0741 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LW07 1.13e-32 112 61 0 95 3 VCM66_A0700 UPF0265 protein VCM66_A0700 Vibrio cholerae serotype O1 (strain M66-2)
Q8RG97 6.19e-32 110 68 0 89 3 FN0411 UPF0265 protein FN0411 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q6LQR1 1.66e-31 109 60 0 93 3 PBPRA1961 UPF0265 protein PBPRA1961 Photobacterium profundum (strain SS9)
Q5DZX0 2.03e-31 109 52 0 95 3 VF_A0606 UPF0265 protein VF_A0606 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5ETZ6 2.03e-31 109 52 0 95 3 VFMJ11_A0615 UPF0265 protein VFMJ11_A0615 Aliivibrio fischeri (strain MJ11)
Q7MD09 5.95e-31 108 56 0 95 3 VVA1227 UPF0265 protein VVA1227 Vibrio vulnificus (strain YJ016)
Q8D5Z0 5.95e-31 108 56 0 95 3 VV2_0759 UPF0265 protein VV2_0759 Vibrio vulnificus (strain CMCP6)
B6ERM4 7.55e-31 108 52 0 95 3 VSAL_II0603 UPF0265 protein VSAL_II0603 Aliivibrio salmonicida (strain LFI1238)
Q87GT9 8.17e-31 108 59 0 93 3 VPA1226 UPF0265 protein VPA1226 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VQW7 1.78e-30 107 59 0 91 3 VS_II0351 UPF0265 protein VS_II0351 Vibrio atlanticus (strain LGP32)
A7N3Z2 2e-30 107 58 0 93 3 VIBHAR_05346 UPF0265 protein VIBHAR_05346 Vibrio campbellii (strain ATCC BAA-1116)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_14765
Feature type CDS
Gene tmaR
Product PTS system regulator TmaR
Location 51141 - 51467 (strand: -1)
Length 327 (nucleotides) / 108 (amino acids)

Contig

Accession contig_19
Length 86773 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1969
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04363 Protein of unknown function (DUF496)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2926 Function unknown (S) S Uncharacterized conserved protein YeeX, DUF496 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09802 uncharacterized protein - -

Protein Sequence

MDNTTKPSFHNVLEFVRMFRRKNKILREITDNEKKIRDNQKRVLLLDNLSEYIKPGMSIEDIQAIIANMRSDYEDRVDEYIIKNADLSKERREISRELKAMGDIKDIK

Flanking regions ( +/- flanking 50bp)

ACCTGTATTGTTTAATGAATCACATTTCAGATATGACTAAGGGTAGAATAATGGACAACACAACCAAGCCTTCCTTTCACAATGTCCTGGAGTTCGTTCGTATGTTTCGCCGTAAAAACAAAATACTGCGTGAAATAACTGACAACGAAAAGAAAATTCGTGATAACCAGAAACGTGTACTTCTGCTTGATAACCTGAGTGAATACATCAAGCCGGGCATGTCCATTGAAGATATCCAGGCTATCATTGCCAATATGCGCAGTGACTATGAAGATCGTGTGGATGAGTACATCATCAAGAATGCGGATCTGTCAAAAGAGCGCCGCGAAATCTCCAGAGAACTCAAAGCGATGGGCGATATCAAAGATATTAAGTAATCGCATTCACTGAACAGCAGAAACCGTGAATTGAATATTCGCGGTTTTTT