Homologs in group_1828

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_08560 EHELCC_08560 100.0 Morganella morganii S2 ybaN DUF454 domain-containing protein
NLDBIP_08885 NLDBIP_08885 100.0 Morganella morganii S4 ybaN DUF454 domain-containing protein
LHKJJB_05380 LHKJJB_05380 100.0 Morganella morganii S3 ybaN DUF454 domain-containing protein
HKOGLL_05535 HKOGLL_05535 100.0 Morganella morganii S5 ybaN DUF454 domain-containing protein
F4V73_RS03225 F4V73_RS03225 86.9 Morganella psychrotolerans - DUF454 family protein
PMI_RS07585 PMI_RS07585 67.7 Proteus mirabilis HI4320 - DUF454 family protein

Distribution of the homologs in the orthogroup group_1828

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1828

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAR7 2.67e-51 162 62 0 124 3 ybaN Inner membrane protein YbaN Shigella flexneri
P0AAR5 2.67e-51 162 62 0 124 1 ybaN Inner membrane protein YbaN Escherichia coli (strain K12)
P0AAR6 2.67e-51 162 62 0 124 3 ybaN Inner membrane protein YbaN Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_13535
Feature type CDS
Gene ybaN
Product DUF454 domain-containing protein
Location 84302 - 84718 (strand: -1)
Length 417 (nucleotides) / 138 (amino acids)

Contig

Accession contig_16
Length 109220 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1828
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04304 Protein of unknown function (DUF454)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2832 Function unknown (S) S Uncharacterized membrane protein YbaN, DUF454 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09790 uncharacterized protein - -

Protein Sequence

MKPFTRILLLLSGWIAVILATLGVVLPVLPTTPFLLLAAWCFSRSSPRFHHWLLYRSWFGGYIRHWQTHKGLPRKAKRRAVIVILLTFAVSLWLVKLIYIRLLLLCILVWLLIFMLRLPETDEMTPENTPASEEKSPD

Flanking regions ( +/- flanking 50bp)

TTACACAACGATAACATTGAGTTGCATTCTCATTACCGGAGACTCAGGACGTGAAGCCGTTCACCCGCATACTGCTGCTGTTATCAGGCTGGATTGCCGTCATACTGGCAACCCTAGGGGTTGTGCTGCCGGTATTGCCGACAACGCCGTTCCTGCTGCTGGCAGCGTGGTGTTTCTCCCGTTCATCTCCCCGGTTCCATCACTGGCTGCTGTACCGCTCCTGGTTCGGCGGCTACATCCGTCACTGGCAGACACACAAAGGCCTGCCGCGCAAAGCAAAACGGCGTGCGGTAATCGTGATCCTGCTGACGTTTGCGGTGTCGCTCTGGCTGGTGAAACTGATTTATATCCGGCTGTTACTGCTGTGTATTCTGGTCTGGCTGCTGATCTTTATGCTGCGCCTGCCGGAAACAGATGAAATGACGCCGGAGAATACCCCGGCGTCAGAGGAGAAATCACCGGATTAATCGCTTTCCGGTAATGTGACATATTGCTGATAAATTGCGTCAAGATTAGC