Homologs in group_1821

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_08595 EHELCC_08595 100.0 Morganella morganii S2 catE VOC family protein
NLDBIP_08920 NLDBIP_08920 100.0 Morganella morganii S4 catE VOC family protein
LHKJJB_05345 LHKJJB_05345 100.0 Morganella morganii S3 catE VOC family protein
HKOGLL_05570 HKOGLL_05570 100.0 Morganella morganii S5 catE VOC family protein
F4V73_RS03260 F4V73_RS03260 77.5 Morganella psychrotolerans - VOC family protein
PMI_RS06565 PMI_RS06565 51.2 Proteus mirabilis HI4320 - VOC family protein

Distribution of the homologs in the orthogroup group_1821

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1821

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P52096 3.82e-48 153 55 0 129 4 yaeR Uncharacterized protein YaeR Escherichia coli (strain K12)
P45871 6.26e-41 135 50 0 126 4 ywkD Uncharacterized protein YwkD Bacillus subtilis (strain 168)
P39586 3.53e-05 43 25 4 131 3 ywbC Uncharacterized protein YwbC Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_13500
Feature type CDS
Gene catE
Product VOC family protein
Location 77553 - 77942 (strand: -1)
Length 390 (nucleotides) / 129 (amino acids)

Contig

Accession contig_16
Length 109220 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1821
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00903 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0346 Secondary metabolites biosynthesis, transport and catabolism (Q) Q Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08234 glyoxylase I family protein - -

Protein Sequence

MLKIEKVDHIAVIASDLTASLAFYCDVLGLTVLSEHYRAERDSYKVELALNGEYLLELFTFPASPPRVSQPEACGLRHLAFAVQDLTAWETHLKQCGVRCDSIRTDEFTGKSFFFCFDPDNLPVEFYAR

Flanking regions ( +/- flanking 50bp)

AAAGCGTGTTAATCAAACGCCCCGGCAACGGGGCGTTATACAGGAAAGATATGCTGAAGATTGAAAAAGTGGATCATATCGCCGTGATTGCTTCTGACCTCACGGCCAGTCTGGCGTTTTATTGTGATGTGCTGGGATTAACCGTGCTCAGTGAACACTACCGTGCGGAACGGGATTCTTACAAAGTGGAGCTGGCACTTAACGGAGAGTATCTGCTGGAGCTTTTTACCTTTCCGGCAAGTCCGCCCCGGGTATCACAGCCGGAAGCCTGTGGTCTGCGTCATCTGGCATTTGCAGTGCAGGATCTGACCGCATGGGAAACACACCTGAAACAATGCGGTGTCCGTTGTGACAGCATCCGCACGGATGAATTTACCGGCAAATCATTTTTCTTCTGTTTTGACCCGGATAATCTGCCGGTGGAGTTTTATGCCCGCTGACGGATAAAAAAAAAGCCAGCGCGATGGCTGGCTGAGAAACTTCGAAATAC