Homologs in group_3758

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS07750 F4V73_RS07750 84.0 Morganella psychrotolerans - class I SAM-dependent methyltransferase

Distribution of the homologs in the orthogroup group_3758

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3758

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P44074 1.62e-41 145 36 5 252 4 HI_0912 Uncharacterized protein HI_0912 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P36571 9.59e-12 66 37 2 100 1 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Serratia marcescens
Q6D3C1 4.98e-10 61 33 2 106 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9FR44 7.12e-10 62 33 2 124 1 NMT1 Phosphoethanolamine N-methyltransferase 1 Arabidopsis thaliana
Q944H0 2.55e-09 60 32 4 143 1 NMT2 Phosphoethanolamine N-methyltransferase 2 Arabidopsis thaliana
E3G327 4.53e-09 58 32 2 110 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Enterobacter lignolyticus (strain SCF1)
Q2SBD7 4.83e-09 58 34 1 100 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Hahella chejuensis (strain KCTC 2396)
D8MPW4 1.94e-08 57 33 2 100 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Erwinia billingiae (strain Eb661)
C8YTM5 3.67e-08 57 31 2 124 1 PEAMT2 Phosphoethanolamine N-methyltransferase Triticum aestivum
A0A1D6NER6 3.69e-08 57 31 2 124 2 PEAMT1 Phosphoethanolamine N-methyltransferase 1 Zea mays
A0A1D6NER6 7.11e-05 47 33 7 128 2 PEAMT1 Phosphoethanolamine N-methyltransferase 1 Zea mays
Q9C6B9 6.19e-08 56 30 2 124 1 NMT3 Phosphoethanolamine N-methyltransferase 3 Arabidopsis thaliana
P12999 6.78e-08 55 31 2 110 1 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Escherichia coli (strain K12)
Q9RX93 1.09e-07 54 33 5 133 3 tam Trans-aconitate 2-methyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
P65347 1.18e-07 53 28 3 127 3 BQ2027_MB0092 Uncharacterized methyltransferase Mb0092 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WK03 1.18e-07 53 28 3 127 3 Rv0089 Uncharacterized methyltransferase Rv0089 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WK02 1.18e-07 53 28 3 127 3 MT0098 Uncharacterized methyltransferase MT0098 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A6UYW3 1.63e-07 54 34 2 98 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pseudomonas aeruginosa (strain PA7)
D2T333 1.77e-07 54 36 3 98 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96)
Q9M571 1.83e-07 54 31 2 124 1 PEAMT Phosphoethanolamine N-methyltransferase Spinacia oleracea
Q9M571 0.000182 45 29 5 129 1 PEAMT Phosphoethanolamine N-methyltransferase Spinacia oleracea
Q54EF2 2.32e-07 54 34 3 105 3 prmt1 Protein arginine N-methyltransferase 1 Dictyostelium discoideum
C4K5L7 3.93e-07 53 31 2 97 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q8ZQQ6 6.75e-07 52 32 2 110 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A1JU33 7.97e-07 52 34 3 103 3 tam Trans-aconitate 2-methyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q818X2 9.58e-07 52 30 2 103 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8VYX1 1.04e-06 52 33 1 103 1 PEAMT1 Phosphoethanolamine N-methyltransferase 1 Triticum aestivum
Q8VYX1 2.38e-06 51 28 7 159 1 PEAMT1 Phosphoethanolamine N-methyltransferase 1 Triticum aestivum
Q81MB2 1.2e-06 51 30 3 103 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Bacillus anthracis
Q5QZ53 1.7e-06 51 27 9 213 3 ubiG Ubiquinone biosynthesis O-methyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q7CH67 1.93e-06 51 32 2 100 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Yersinia pestis
Q89AK7 2.84e-06 50 31 2 99 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O06898 5.17e-06 49 34 2 98 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pseudescherichia vulneris
Q21FY5 5.21e-06 50 26 2 105 3 bioC Biotin biosynthesis bifunctional protein BioHC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A9KGL7 5.44e-06 49 31 2 106 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain Dugway 5J108-111)
B6J5Y2 5.65e-06 49 31 2 106 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain CbuK_Q154)
A1K8U5 5.8e-06 49 27 7 181 3 tam Trans-aconitate 2-methyltransferase Azoarcus sp. (strain BH72)
P38074 5.84e-06 50 33 4 113 1 HMT1 Protein arginine N-methyltransferase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q820B5 6.7e-06 49 31 2 106 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBI0 6.7e-06 49 31 2 106 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J1W2 6.7e-06 49 31 2 106 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain CbuG_Q212)
Q4FVG3 7.41e-06 49 34 4 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1QEI9 9.02e-06 49 34 4 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q0VQX6 1.16e-05 48 31 2 115 3 cmoB tRNA U34 carboxymethyltransferase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q1IDA6 1.68e-05 48 31 4 107 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas entomophila (strain L48)
B2GV71 1.91e-05 48 27 1 94 2 Ndufaf5 Arginine-hydroxylase NDUFAF5, mitochondrial Rattus norvegicus
P54458 2.06e-05 48 30 9 150 3 yqeM Putative methyltransferase YqeM Bacillus subtilis (strain 168)
B2IAI0 2.45e-05 48 33 4 106 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Xylella fastidiosa (strain M23)
Q5TEU4 3.39e-05 47 30 2 94 1 NDUFAF5 Arginine-hydroxylase NDUFAF5, mitochondrial Homo sapiens
Q2L2T5 3.94e-05 47 33 5 115 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella avium (strain 197N)
Q3IIQ3 4.3e-05 47 28 4 133 3 cmoB tRNA U34 carboxymethyltransferase Pseudoalteromonas translucida (strain TAC 125)
A0PQX0 4.72e-05 47 25 4 150 3 MUL_2377 Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 1 Mycobacterium ulcerans (strain Agy99)
A0QUV5 4.83e-05 47 28 2 117 1 MSMEG_2350 Probable S-adenosylmethionine-dependent methyltransferase MSMEG_2350/MSMEI_2290 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q22993 5.21e-05 47 26 1 103 1 pmt-2 Phosphoethanolamine N-methyltransferase 2 Caenorhabditis elegans
B0V5X4 5.24e-05 46 35 5 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AYE)
B7IBN2 5.24e-05 46 35 5 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AB0057)
B7H2Y9 5.24e-05 46 35 5 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AB307-0294)
B0VMN8 5.39e-05 46 35 5 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain SDF)
P74388 5.56e-05 47 29 3 115 1 sll0418 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q3K8T6 5.96e-05 46 30 4 107 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain Pf0-1)
B2I023 6.09e-05 46 35 5 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain ACICU)
O60678 6.33e-05 47 32 3 103 1 PRMT3 Protein arginine N-methyltransferase 3 Homo sapiens
Q4K8M4 7.47e-05 46 31 4 106 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q47GP8 8.43e-05 46 31 4 107 3 ubiG Ubiquinone biosynthesis O-methyltransferase Dechloromonas aromatica (strain RCB)
D5DIV9 0.000106 46 26 2 100 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Priestia megaterium (strain DSM 319 / IMG 1521)
B7VM52 0.00013 45 28 7 167 3 prmA Ribosomal protein L11 methyltransferase Vibrio atlanticus (strain LGP32)
O13648 0.000138 46 32 1 75 1 rmt3 Ribosomal protein arginine N-methyltransferase rmt3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B4S0J9 0.000156 45 25 2 122 3 cmoB tRNA U34 carboxymethyltransferase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B1J5G4 0.000185 45 31 4 107 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain W619)
Q21IR9 0.000193 45 29 3 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q83CU8 0.000201 45 25 2 115 3 bioC2 Malonyl-[acyl-carrier protein] O-methyltransferase 2 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A1K8Q1 0.000202 45 32 3 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Azoarcus sp. (strain BH72)
D9SJ16 0.000205 45 30 3 114 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Gallionella capsiferriformans (strain ES-2)
B7LRD2 0.000223 45 36 4 99 3 tam Trans-aconitate 2-methyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P44167 0.000226 45 25 2 118 1 cmoB tRNA U34 carboxymethyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A2APY7 0.000227 45 26 1 94 1 Ndufaf5 Arginine-hydroxylase NDUFAF5, mitochondrial Mus musculus
Q6FFY1 0.000265 44 34 5 107 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A5UEI8 0.000266 45 25 2 118 3 cmoB tRNA U34 carboxymethyltransferase Haemophilus influenzae (strain PittGG)
A5UBW0 0.000266 45 25 2 118 3 cmoB tRNA U34 carboxymethyltransferase Haemophilus influenzae (strain PittEE)
Q87KU2 0.000271 45 26 8 171 3 prmA Ribosomal protein L11 methyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C5BMZ8 0.000272 45 27 2 106 3 bioC Biotin biosynthesis bifunctional protein BioHC Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q9URX7 0.000279 45 32 2 80 1 rmt1 Protein arginine N-methyltransferase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q4QK61 0.000308 44 25 2 118 3 cmoB tRNA U34 carboxymethyltransferase Haemophilus influenzae (strain 86-028NP)
Q3J8U2 0.000321 44 32 3 106 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q5RBS1 0.000347 44 29 2 94 2 NDUFAF5 Arginine-hydroxylase NDUFAF5, mitochondrial Pongo abelii
A7GSD9 0.000374 44 22 4 170 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q0T4L2 0.000374 44 36 4 99 3 tam Trans-aconitate 2-methyltransferase Shigella flexneri serotype 5b (strain 8401)
Q8TJK1 0.000379 44 28 5 156 1 arsM Arsenite methyltransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q83RE0 0.000381 44 36 4 99 3 tam Trans-aconitate 2-methyltransferase Shigella flexneri
Q9CD86 0.00039 44 22 2 134 3 ML0130 Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase Mycobacterium leprae (strain TN)
A1W9K6 0.000398 44 31 3 99 3 tam Trans-aconitate 2-methyltransferase Acidovorax sp. (strain JS42)
Q32G05 0.000403 44 36 4 99 3 tam Trans-aconitate 2-methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
B9MBN9 0.000421 44 31 3 99 3 tam Trans-aconitate 2-methyltransferase Acidovorax ebreus (strain TPSY)
Q8DD03 0.000425 44 26 8 171 3 prmA Ribosomal protein L11 methyltransferase Vibrio vulnificus (strain CMCP6)
B5Z1X6 0.000434 43 36 4 99 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAZ2 0.000434 43 36 4 99 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O157:H7
B0KTX4 0.000456 43 30 4 107 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain GB-1)
Q88M10 0.000482 43 30 4 107 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W7G3 0.000482 43 30 4 107 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
C3K6J1 0.000501 43 29 4 107 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain SBW25)
Q5R0Q5 0.000516 44 27 3 117 3 cmoB tRNA U34 carboxymethyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q0HQK1 0.000578 43 28 6 145 3 prmA Ribosomal protein L11 methyltransferase Shewanella sp. (strain MR-7)
Q0HN86 0.000578 43 28 6 145 3 prmA Ribosomal protein L11 methyltransferase Shewanella sp. (strain MR-4)
A0KS74 0.000578 43 28 6 145 3 prmA Ribosomal protein L11 methyltransferase Shewanella sp. (strain ANA-3)
Q609G2 0.000642 43 29 2 106 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B7N4U4 0.000755 43 35 3 95 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A6W0X8 0.0008 43 30 2 108 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Marinomonas sp. (strain MWYL1)
A6WTE5 0.000804 43 29 6 145 3 prmA Ribosomal protein L11 methyltransferase Shewanella baltica (strain OS185)
Q8FHF2 0.000813 43 34 4 101 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q2SJW1 0.000817 43 29 2 118 3 cmoB tRNA U34 carboxymethyltransferase Hahella chejuensis (strain KCTC 2396)
B7URP6 0.000843 43 35 4 99 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q54818 0.000856 43 27 3 115 1 dnrC Aklanonic acid methyltransferase DnrC Streptomyces peucetius
Q63QN9 0.000872 43 28 5 116 3 prmA Ribosomal protein L11 methyltransferase Burkholderia pseudomallei (strain K96243)
A1V0M1 0.00088 43 28 5 116 3 prmA Ribosomal protein L11 methyltransferase Burkholderia mallei (strain SAVP1)
Q62GX2 0.00088 43 28 5 116 3 prmA Ribosomal protein L11 methyltransferase Burkholderia mallei (strain ATCC 23344)
A2S5P8 0.00088 43 28 5 116 3 prmA Ribosomal protein L11 methyltransferase Burkholderia mallei (strain NCTC 10229)
A3MRB1 0.00088 43 28 5 116 3 prmA Ribosomal protein L11 methyltransferase Burkholderia mallei (strain NCTC 10247)
A3NDQ7 0.001 43 28 5 116 3 prmA Ribosomal protein L11 methyltransferase Burkholderia pseudomallei (strain 668)
Q3JNI0 0.001 43 28 5 116 3 prmA Ribosomal protein L11 methyltransferase Burkholderia pseudomallei (strain 1710b)
Q8LBV4 0.001 43 25 3 130 1 At1g78140 Uncharacterized methyltransferase At1g78140, chloroplastic Arabidopsis thaliana
Q8EJR7 0.001 43 28 6 145 3 prmA Ribosomal protein L11 methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q1RBP8 0.001 43 35 4 99 3 tam Trans-aconitate 2-methyltransferase Escherichia coli (strain UTI89 / UPEC)
B7MMY3 0.001 43 35 4 99 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_12520
Feature type CDS
Gene tam
Product Trans-aconitate methyltransferase
Location 20172 - 20906 (strand: -1)
Length 735 (nucleotides) / 244 (amino acids)
In genomic island -

Contig

Accession contig_15
Length 114235 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3758
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF08241 Methyltransferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2227 Coenzyme transport and metabolism (H) H 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase

Protein Sequence

MSQNIYDNPDFFAGYATLPRSAEGLDGAPEWTAMQTLLPSLAGKSVIDLGCGYGWFCRWAKEQGADRVTGFDLSEKMLAKAASMTTDPDITWLRADLETLQLPAAQSDVIYSSLALHYLRDIPALFATLFQALVAGGSLIFSAEHPIYTAPVIQNWCTDSAGNKAWPVNQYQQEGVRISNWFADGVEKQHRKLSTWINALITAGFEITAMNEWGPSAAQIAANPALDEEKERPMIFLLSARKPE

Flanking regions ( +/- flanking 50bp)

GAAACCGGCAAACTATGAATATAATTTGCTCGTTATTTAAGGAGTAAGTTATGTCTCAGAATATTTATGATAATCCTGATTTCTTTGCCGGTTATGCCACGCTGCCCCGCTCAGCAGAAGGACTGGACGGCGCGCCGGAGTGGACTGCCATGCAGACATTGCTGCCGTCACTGGCCGGGAAGTCAGTGATCGACCTGGGGTGCGGATATGGCTGGTTTTGCCGCTGGGCAAAAGAGCAGGGTGCTGACCGGGTGACCGGTTTTGATCTGTCTGAGAAAATGCTGGCGAAAGCCGCATCGATGACCACGGATCCGGATATTACCTGGCTGCGTGCTGATCTCGAGACACTGCAATTACCGGCGGCACAAAGTGATGTGATTTACAGCTCACTGGCACTGCATTATCTGCGTGATATCCCGGCACTGTTTGCCACGCTGTTTCAGGCGCTGGTCGCGGGCGGCAGTCTGATTTTTTCCGCAGAACACCCGATCTACACAGCTCCCGTCATTCAGAACTGGTGTACGGATAGTGCAGGTAATAAAGCCTGGCCGGTCAATCAGTATCAGCAGGAAGGCGTCAGGATCAGCAACTGGTTTGCCGACGGTGTGGAAAAGCAGCACCGGAAATTATCCACCTGGATAAATGCACTGATTACAGCCGGTTTTGAAATCACCGCCATGAATGAGTGGGGACCGTCAGCGGCACAGATTGCCGCCAACCCGGCACTGGATGAAGAAAAAGAACGGCCGATGATCTTTCTGCTCAGCGCCCGCAAGCCGGAATAGTGGCTGACGGGCGGGTTTGTTCCGCAGTTTACAGCGTGAATTTATGCTTT