Homologs in group_3744
1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| FBDBKF_12520 | FBDBKF_12520 | 84.0 | Morganella morganii S1 | tam | Trans-aconitate methyltransferase |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| P44074 | 1.13e-41 | 145 | 36 | 5 | 250 | 4 | HI_0912 | Uncharacterized protein HI_0912 | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| P12999 | 5.97e-13 | 69 | 31 | 5 | 166 | 1 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Escherichia coli (strain K12) |
| Q6D3C1 | 8.41e-13 | 69 | 34 | 2 | 121 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) |
| D8MPW4 | 5.55e-12 | 67 | 35 | 2 | 100 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Erwinia billingiae (strain Eb661) |
| E3G327 | 1.15e-11 | 66 | 33 | 2 | 129 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Enterobacter lignolyticus (strain SCF1) |
| P36571 | 4.06e-11 | 64 | 35 | 2 | 100 | 1 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Serratia marcescens |
| Q944H0 | 1.06e-10 | 64 | 32 | 4 | 143 | 1 | NMT2 | Phosphoethanolamine N-methyltransferase 2 | Arabidopsis thaliana |
| Q9FR44 | 1.53e-10 | 63 | 33 | 2 | 124 | 1 | NMT1 | Phosphoethanolamine N-methyltransferase 1 | Arabidopsis thaliana |
| Q89AK7 | 1.76e-10 | 62 | 35 | 2 | 99 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) |
| C8YTM5 | 7.08e-10 | 62 | 31 | 2 | 124 | 1 | PEAMT2 | Phosphoethanolamine N-methyltransferase | Triticum aestivum |
| A0A1D6NER6 | 7.33e-10 | 62 | 30 | 3 | 143 | 2 | PEAMT1 | Phosphoethanolamine N-methyltransferase 1 | Zea mays |
| A0A1D6NER6 | 0.000299 | 45 | 33 | 5 | 112 | 2 | PEAMT1 | Phosphoethanolamine N-methyltransferase 1 | Zea mays |
| Q2SBD7 | 1.62e-09 | 60 | 30 | 1 | 114 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Hahella chejuensis (strain KCTC 2396) |
| D2T333 | 4.68e-09 | 58 | 33 | 4 | 127 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96) |
| A6UYW3 | 8.21e-09 | 58 | 34 | 3 | 115 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Pseudomonas aeruginosa (strain PA7) |
| Q9C6B9 | 1.14e-08 | 58 | 30 | 2 | 124 | 1 | NMT3 | Phosphoethanolamine N-methyltransferase 3 | Arabidopsis thaliana |
| Q9M571 | 1.32e-08 | 58 | 31 | 2 | 124 | 1 | PEAMT | Phosphoethanolamine N-methyltransferase | Spinacia oleracea |
| Q9M571 | 1.83e-05 | 48 | 31 | 4 | 111 | 1 | PEAMT | Phosphoethanolamine N-methyltransferase | Spinacia oleracea |
| L0E172 | 1.48e-08 | 57 | 24 | 5 | 182 | 3 | phqN | Methyltransferase phqN | Penicillium fellutanum |
| Q9RX93 | 3.08e-08 | 56 | 36 | 3 | 107 | 3 | tam | Trans-aconitate 2-methyltransferase | Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) |
| Q8ZQQ6 | 4.63e-08 | 55 | 33 | 3 | 124 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| Q8VYX1 | 6.23e-08 | 56 | 33 | 1 | 103 | 1 | PEAMT1 | Phosphoethanolamine N-methyltransferase 1 | Triticum aestivum |
| Q8VYX1 | 5.25e-05 | 47 | 26 | 5 | 153 | 1 | PEAMT1 | Phosphoethanolamine N-methyltransferase 1 | Triticum aestivum |
| Q21FY5 | 7.35e-08 | 56 | 29 | 3 | 134 | 3 | bioC | Biotin biosynthesis bifunctional protein BioHC | Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) |
| Q7CH67 | 1.22e-07 | 54 | 34 | 2 | 100 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Yersinia pestis |
| P65347 | 3.34e-07 | 52 | 33 | 3 | 109 | 3 | BQ2027_MB0092 | Uncharacterized methyltransferase Mb0092 | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
| P9WK03 | 3.34e-07 | 52 | 33 | 3 | 109 | 3 | Rv0089 | Uncharacterized methyltransferase Rv0089 | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| P9WK02 | 3.34e-07 | 52 | 33 | 3 | 109 | 3 | MT0098 | Uncharacterized methyltransferase MT0098 | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Q5QZ53 | 3.69e-07 | 53 | 36 | 3 | 105 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) |
| Q8TJK1 | 6.92e-07 | 52 | 31 | 2 | 105 | 1 | arsM | Arsenite methyltransferase | Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) |
| Q8LBV4 | 8.44e-07 | 52 | 30 | 3 | 130 | 1 | At1g78140 | Uncharacterized methyltransferase At1g78140, chloroplastic | Arabidopsis thaliana |
| C5BMZ8 | 9.17e-07 | 52 | 28 | 2 | 129 | 3 | bioC | Biotin biosynthesis bifunctional protein BioHC | Teredinibacter turnerae (strain ATCC 39867 / T7901) |
| P54458 | 9.51e-07 | 52 | 32 | 10 | 150 | 3 | yqeM | Putative methyltransferase YqeM | Bacillus subtilis (strain 168) |
| C4K5L7 | 9.54e-07 | 52 | 29 | 3 | 131 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) |
| Q4FVG3 | 1.03e-06 | 52 | 34 | 4 | 108 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4) |
| O06898 | 1.15e-06 | 51 | 33 | 2 | 112 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Pseudescherichia vulneris |
| Q3K8T6 | 1.2e-06 | 51 | 33 | 4 | 107 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Pseudomonas fluorescens (strain Pf0-1) |
| P74388 | 1.3e-06 | 52 | 25 | 3 | 138 | 1 | sll0418 | 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase | Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa) |
| B6J5Y2 | 1.32e-06 | 51 | 31 | 2 | 106 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Coxiella burnetii (strain CbuK_Q154) |
| E4QJB8 | 1.36e-06 | 51 | 34 | 3 | 117 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Methylovorus sp. (strain MP688) |
| A9KGL7 | 1.37e-06 | 51 | 31 | 2 | 106 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Coxiella burnetii (strain Dugway 5J108-111) |
| Q22993 | 1.39e-06 | 52 | 26 | 1 | 103 | 1 | pmt-2 | Phosphoethanolamine N-methyltransferase 2 | Caenorhabditis elegans |
| D9SJ16 | 1.48e-06 | 51 | 32 | 2 | 124 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Gallionella capsiferriformans (strain ES-2) |
| Q1IDA6 | 1.48e-06 | 51 | 33 | 4 | 107 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Pseudomonas entomophila (strain L48) |
| Q4K8M4 | 1.58e-06 | 51 | 33 | 4 | 106 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) |
| Q820B5 | 1.64e-06 | 51 | 31 | 2 | 106 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Coxiella burnetii (strain RSA 493 / Nine Mile phase I) |
| A9NBI0 | 1.64e-06 | 51 | 31 | 2 | 106 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Coxiella burnetii (strain RSA 331 / Henzerling II) |
| B6J1W2 | 1.64e-06 | 51 | 31 | 2 | 106 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Coxiella burnetii (strain CbuG_Q212) |
| G0FUS0 | 1.81e-06 | 51 | 30 | 1 | 110 | 1 | RAM_03320 | 27-O-demethylrifamycin SV methyltransferase | Amycolatopsis mediterranei (strain S699) |
| Q1QEI9 | 2.41e-06 | 50 | 33 | 4 | 108 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5) |
| Q9RMN9 | 2.88e-06 | 50 | 24 | 1 | 113 | 3 | mtf2 | Fatty-acid O-methyltransferase | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) |
| C3K6J1 | 3.07e-06 | 50 | 33 | 4 | 107 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Pseudomonas fluorescens (strain SBW25) |
| Q2L2T5 | 3.43e-06 | 50 | 32 | 4 | 116 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Bordetella avium (strain 197N) |
| Q818X2 | 4.58e-06 | 50 | 27 | 2 | 103 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) |
| Q81MB2 | 4.84e-06 | 50 | 26 | 2 | 99 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Bacillus anthracis |
| Q9L9F3 | 6.21e-06 | 49 | 28 | 4 | 130 | 1 | novO | 8-demethylnovobiocic acid C(8)-methyltransferase | Streptomyces niveus |
| A0QUV5 | 6.88e-06 | 49 | 27 | 3 | 137 | 1 | MSMEG_2350 | Probable S-adenosylmethionine-dependent methyltransferase MSMEG_2350/MSMEI_2290 | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) |
| Q54EF2 | 7.11e-06 | 49 | 31 | 2 | 104 | 3 | prmt1 | Protein arginine N-methyltransferase 1 | Dictyostelium discoideum |
| A6W0X8 | 8.35e-06 | 49 | 30 | 2 | 123 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Marinomonas sp. (strain MWYL1) |
| A0PQX0 | 8.79e-06 | 49 | 25 | 4 | 150 | 3 | MUL_2377 | Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 1 | Mycobacterium ulcerans (strain Agy99) |
| A1W9K6 | 9.59e-06 | 48 | 33 | 4 | 104 | 3 | tam | Trans-aconitate 2-methyltransferase | Acidovorax sp. (strain JS42) |
| B9MBN9 | 1.01e-05 | 48 | 33 | 4 | 104 | 3 | tam | Trans-aconitate 2-methyltransferase | Acidovorax ebreus (strain TPSY) |
| Q9CD86 | 1.09e-05 | 48 | 24 | 2 | 134 | 3 | ML0130 | Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase | Mycobacterium leprae (strain TN) |
| B1J5G4 | 1.12e-05 | 48 | 33 | 4 | 107 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Pseudomonas putida (strain W619) |
| B0KTX4 | 1.12e-05 | 48 | 32 | 4 | 107 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Pseudomonas putida (strain GB-1) |
| Q88M10 | 1.27e-05 | 48 | 32 | 4 | 107 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) |
| A5W7G3 | 1.27e-05 | 48 | 32 | 4 | 107 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1) |
| B2IAI0 | 1.57e-05 | 48 | 29 | 4 | 122 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Xylella fastidiosa (strain M23) |
| B2GV71 | 1.58e-05 | 48 | 27 | 1 | 94 | 2 | Ndufaf5 | Arginine-hydroxylase NDUFAF5, mitochondrial | Rattus norvegicus |
| Q5P7U3 | 1.83e-05 | 48 | 32 | 3 | 105 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1) |
| Q07VB6 | 1.92e-05 | 48 | 28 | 3 | 107 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Rhodopseudomonas palustris (strain BisA53) |
| A6UCF6 | 1.94e-05 | 48 | 27 | 2 | 104 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Sinorhizobium medicae (strain WSM419) |
| Q4W9V1 | 2.16e-05 | 48 | 21 | 4 | 170 | 1 | erg6 | Sterol 24-C-methyltransferase erg6 | Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) |
| Q98K73 | 2.2e-05 | 48 | 33 | 4 | 111 | 3 | tam | Trans-aconitate 2-methyltransferase | Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) |
| Q83CU8 | 2.45e-05 | 47 | 28 | 1 | 101 | 3 | bioC2 | Malonyl-[acyl-carrier protein] O-methyltransferase 2 | Coxiella burnetii (strain RSA 493 / Nine Mile phase I) |
| Q5ZT34 | 3.58e-05 | 47 | 25 | 5 | 139 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) |
| Q3SK91 | 4.42e-05 | 47 | 33 | 3 | 108 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Thiobacillus denitrificans (strain ATCC 25259) |
| O13648 | 4.72e-05 | 47 | 29 | 2 | 116 | 1 | rmt3 | Ribosomal protein arginine N-methyltransferase rmt3 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| A8G8B8 | 4.78e-05 | 47 | 30 | 5 | 123 | 3 | ubiE | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | Serratia proteamaculans (strain 568) |
| Q02PX7 | 4.99e-05 | 46 | 30 | 4 | 107 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Pseudomonas aeruginosa (strain UCBPP-PA14) |
| A0A0E0SMA3 | 5.09e-05 | 47 | 19 | 4 | 183 | 2 | ERG6B | Sterol 24-C-methyltransferase ERG6B | Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) |
| B7VM52 | 5.68e-05 | 47 | 28 | 6 | 145 | 3 | prmA | Ribosomal protein L11 methyltransferase | Vibrio atlanticus (strain LGP32) |
| A6V2Q4 | 6.19e-05 | 46 | 31 | 4 | 106 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Pseudomonas aeruginosa (strain PA7) |
| B7V9J5 | 6.74e-05 | 46 | 31 | 4 | 106 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Pseudomonas aeruginosa (strain LESB58) |
| Q9HZ63 | 6.86e-05 | 46 | 31 | 4 | 106 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| A1K8U5 | 7.98e-05 | 46 | 33 | 4 | 109 | 3 | tam | Trans-aconitate 2-methyltransferase | Azoarcus sp. (strain BH72) |
| Q609G2 | 8.21e-05 | 46 | 31 | 4 | 107 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) |
| Q9F8T9 | 8.41e-05 | 46 | 28 | 7 | 147 | 1 | couO | C-methyltransferase CouO | Streptomyces rishiriensis |
| C5CSI6 | 8.52e-05 | 46 | 32 | 2 | 105 | 3 | tam | Trans-aconitate 2-methyltransferase | Variovorax paradoxus (strain S110) |
| Q47GP8 | 8.84e-05 | 45 | 30 | 4 | 108 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Dechloromonas aromatica (strain RCB) |
| A1JU33 | 9.05e-05 | 46 | 30 | 5 | 133 | 3 | tam | Trans-aconitate 2-methyltransferase | Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) |
| Q8DD03 | 9.34e-05 | 46 | 28 | 6 | 145 | 3 | prmA | Ribosomal protein L11 methyltransferase | Vibrio vulnificus (strain CMCP6) |
| Q7MQ33 | 9.74e-05 | 46 | 29 | 5 | 124 | 3 | ubiE | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | Vibrio vulnificus (strain YJ016) |
| Q8DDP9 | 9.74e-05 | 46 | 29 | 5 | 124 | 3 | ubiE | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | Vibrio vulnificus (strain CMCP6) |
| Q4ZQ90 | 9.79e-05 | 45 | 31 | 4 | 106 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Pseudomonas syringae pv. syringae (strain B728a) |
| Q48FM4 | 9.79e-05 | 45 | 31 | 4 | 106 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) |
| A7MTX1 | 0.000105 | 45 | 31 | 5 | 126 | 3 | ubiE | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | Vibrio campbellii (strain ATCC BAA-1116) |
| P60094 | 0.000111 | 46 | 28 | 6 | 145 | 3 | prmA | Ribosomal protein L11 methyltransferase | Vibrio vulnificus (strain YJ016) |
| Q13EZ9 | 0.00012 | 45 | 27 | 4 | 108 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Rhodopseudomonas palustris (strain BisB5) |
| Q885T9 | 0.000148 | 45 | 31 | 4 | 107 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) |
| Q5TEU4 | 0.00015 | 45 | 29 | 2 | 94 | 1 | NDUFAF5 | Arginine-hydroxylase NDUFAF5, mitochondrial | Homo sapiens |
| B0UPF4 | 0.00015 | 45 | 33 | 5 | 113 | 3 | tam | Trans-aconitate 2-methyltransferase | Methylobacterium sp. (strain 4-46) |
| A1WVM4 | 0.000158 | 45 | 26 | 3 | 119 | 3 | bioC | Malonyl-[acyl-carrier protein] O-methyltransferase | Halorhodospira halophila (strain DSM 244 / SL1) |
| Q3IIQ3 | 0.000163 | 45 | 28 | 5 | 135 | 3 | cmoB | tRNA U34 carboxymethyltransferase | Pseudoalteromonas translucida (strain TAC 125) |
| Q3J8U2 | 0.000166 | 45 | 33 | 3 | 106 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) |
| A1SRS4 | 0.000166 | 45 | 29 | 4 | 113 | 3 | ubiE | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37) |
| I1RGC4 | 0.000175 | 45 | 21 | 4 | 174 | 2 | FG02783.1 | Sterol 24-C-methyltransferase ERG6A | Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) |
| Q7VZG7 | 0.000175 | 45 | 31 | 3 | 112 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) |
| Q54I98 | 0.000186 | 45 | 22 | 4 | 189 | 1 | smt1 | Probable cycloartenol-C-24-methyltransferase 1 | Dictyostelium discoideum |
| Q7WGT9 | 0.000187 | 45 | 31 | 3 | 112 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) |
| B3PI89 | 0.000188 | 45 | 27 | 2 | 136 | 3 | bioC | Biotin biosynthesis bifunctional protein BioHC | Cellvibrio japonicus (strain Ueda107) |
| P96576 | 0.000204 | 44 | 29 | 1 | 96 | 3 | ydaC | Uncharacterized methyltransferase YdaC | Bacillus subtilis (strain 168) |
| A2APY7 | 0.000209 | 45 | 26 | 1 | 94 | 1 | Ndufaf5 | Arginine-hydroxylase NDUFAF5, mitochondrial | Mus musculus |
| Q6N3Y0 | 0.000214 | 45 | 27 | 2 | 105 | 1 | arsM | Arsenite methyltransferase | Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) |
| A4VLX7 | 0.000225 | 44 | 33 | 3 | 106 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Stutzerimonas stutzeri (strain A1501) |
| P9WIN3 | 0.000235 | 45 | 24 | 3 | 137 | 1 | Rv2952 | Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| P9WIN2 | 0.000235 | 45 | 24 | 3 | 137 | 3 | MT3026 | Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| A5U6W0 | 0.000235 | 45 | 24 | 3 | 137 | 3 | MRA_2979 | Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase | Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) |
| A1KMU6 | 0.000235 | 45 | 24 | 3 | 137 | 3 | BCG_2973 | Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase | Mycobacterium bovis (strain BCG / Pasteur 1173P2) |
| Q7TXK3 | 0.000235 | 45 | 24 | 3 | 137 | 3 | BQ2027_MB2976 | Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
| Q5RBS1 | 0.000311 | 44 | 27 | 1 | 94 | 2 | NDUFAF5 | Arginine-hydroxylase NDUFAF5, mitochondrial | Pongo abelii |
| Q2NSL7 | 0.000349 | 44 | 28 | 4 | 107 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Sodalis glossinidius (strain morsitans) |
| B9JB78 | 0.000351 | 44 | 26 | 2 | 101 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Rhizobium rhizogenes (strain K84 / ATCC BAA-868) |
| Q28VP7 | 0.000354 | 44 | 27 | 2 | 104 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Jannaschia sp. (strain CCS1) |
| Q0WPT7 | 0.000374 | 44 | 25 | 2 | 119 | 1 | At2g41040 | Uncharacterized methyltransferase At2g41040, chloroplastic | Arabidopsis thaliana |
| Q9JWE6 | 0.000384 | 44 | 29 | 2 | 106 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) |
| Q6AIL0 | 0.00042 | 44 | 26 | 3 | 119 | 3 | cmoB | tRNA U34 carboxymethyltransferase | Desulfotalea psychrophila (strain LSv54 / DSM 12343) |
| B6ENA3 | 0.000452 | 44 | 29 | 4 | 144 | 3 | prmA | Ribosomal protein L11 methyltransferase | Aliivibrio salmonicida (strain LFI1238) |
| Q6LLY5 | 0.000496 | 43 | 26 | 5 | 145 | 3 | prmA | Ribosomal protein L11 methyltransferase | Photobacterium profundum (strain SS9) |
| B3PP83 | 0.000547 | 43 | 28 | 3 | 105 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Rhizobium etli (strain CIAT 652) |
| Q0VQX6 | 0.000602 | 43 | 26 | 1 | 115 | 3 | cmoB | tRNA U34 carboxymethyltransferase | Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) |
| Q92RC5 | 0.000696 | 43 | 29 | 3 | 107 | 3 | tam | Trans-aconitate 2-methyltransferase | Rhizobium meliloti (strain 1021) |
| Q6FFY1 | 0.000735 | 43 | 28 | 3 | 107 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) |
| Q9JXI7 | 0.000792 | 43 | 29 | 2 | 106 | 3 | ubiG | Ubiquinone biosynthesis O-methyltransferase | Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58) |
| B3PFU1 | 0.001 | 43 | 25 | 1 | 116 | 3 | cmoB | tRNA U34 carboxymethyltransferase | Cellvibrio japonicus (strain Ueda107) |
| Source | Morganella psychrotolerans |
|---|---|
| Locus tag | F4V73_RS07750 |
| Feature type | CDS |
| Gene | - |
| Product | class I SAM-dependent methyltransferase |
| Location | 1619313 - 1620047 (strand: -1) |
| Length | 735 (nucleotides) / 244 (amino acids) |
| Accession | term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object |
|---|---|
| Length | 2012992 nucleotides |
| Topology | linear |
| Plasmid | False |
| Orthogroup | group_3744 | |
|---|---|---|
| Orthogroup size | 2 | |
| N. genomes | 2 |
MSQNIYDDPDFFTGYASLPRSVEGLNGAPEWAAMQALLPSLAGKSVIDLGCGYGWFCRWARTQLASQVSGFDLSEKMLIKAASMTQDSGILYHRADLETLSLPAAQSDVIYSSLALHYLRDIPALFTTLFRALTPGGMLIFSAEHPIYTAPVVQAWSTDSEGNRAWPVNQYQQEGVRISNWFADGVEKQHRKLSTWINLLIASGFEIVAMDEWGPSAEQIAENPALDEEKERPMIFLLSARKPD
TGTCTGTCGATCAGGAACATCCCCGGTATTTATTAGGTAAGGCGTAACATATGTCTCAGAATATTTATGATGATCCGGATTTTTTTACCGGCTATGCCTCGCTGCCCCGGTCTGTAGAGGGATTGAACGGTGCGCCGGAATGGGCCGCAATGCAGGCTCTCTTGCCATCACTTGCCGGAAAATCAGTTATCGACCTCGGTTGTGGCTATGGCTGGTTTTGTCGCTGGGCGCGGACACAACTTGCTTCACAGGTTAGCGGGTTTGATCTGTCTGAAAAAATGCTGATAAAAGCAGCATCCATGACACAAGACAGCGGTATCTTATATCATCGTGCTGATCTGGAGACCCTTTCATTGCCTGCCGCACAAAGCGATGTGATTTACAGCTCCCTTGCTCTTCATTATCTGCGGGATATTCCGGCACTGTTTACAACATTGTTCCGGGCACTGACACCCGGGGGCATGCTGATTTTCTCAGCAGAACATCCGATCTATACTGCACCGGTTGTGCAGGCATGGAGCACGGACAGCGAAGGAAACAGAGCCTGGCCGGTAAATCAGTATCAGCAGGAAGGTGTGCGCATCAGTAATTGGTTTGCTGATGGCGTGGAGAAACAGCACCGGAAGTTATCCACATGGATAAACCTGCTGATTGCATCTGGTTTTGAAATAGTCGCGATGGATGAATGGGGGCCGTCAGCAGAACAAATTGCTGAAAATCCGGCACTGGATGAAGAAAAAGAGCGTCCGATGATCTTCCTTCTGAGCGCCCGCAAGCCGGATTAATGGCGGCGGGCTTAACGATTACTCTTTTTCCATACTCACATGAAATATTT
