Homologs in group_107

Help

10 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00185 FBDBKF_00185 37.2 Morganella morganii S1 - Phage antitermination protein Q
FBDBKF_12850 FBDBKF_12850 25.9 Morganella morganii S1 - Phage antitermination protein Q
EHELCC_01360 EHELCC_01360 37.2 Morganella morganii S2 - Phage antitermination protein Q
NLDBIP_02100 NLDBIP_02100 37.2 Morganella morganii S4 - Phage antitermination protein Q
LHKJJB_03615 LHKJJB_03615 37.2 Morganella morganii S3 - Phage antitermination protein Q
HKOGLL_03430 HKOGLL_03430 37.2 Morganella morganii S5 - Phage antitermination protein Q
F4V73_RS06180 F4V73_RS06180 18.8 Morganella psychrotolerans - antiterminator Q family protein
PMI_RS04475 PMI_RS04475 39.4 Proteus mirabilis HI4320 - antiterminator Q family protein
PMI_RS04675 PMI_RS04675 53.8 Proteus mirabilis HI4320 - antiterminator Q family protein
PMI_RS04845 PMI_RS04845 19.7 Proteus mirabilis HI4320 - antiterminator Q family protein

Distribution of the homologs in the orthogroup group_107

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_107

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9T1U3 2.18e-40 135 52 0 124 3 5 Probable antitermination protein Q Acyrthosiphon pisum secondary endosymbiont phage 1
Q47274 1.09e-22 89 38 1 128 3 quuD Prophage antitermination protein Q homolog QuuD Escherichia coli (strain K12)
O48429 8.48e-20 82 38 2 127 3 Q Antitermination protein Q Enterobacteria phage H19B
P68923 9.44e-20 82 39 1 126 3 Q Antitermination protein Q Enterobacteria phage VT2-Sa
P68922 9.44e-20 82 39 1 126 3 Q Antitermination protein Q Escherichia phage 933W

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_12355
Feature type CDS
Gene -
Product Antitermination protein Q
Location 642 - 1082 (strand: -1)
Length 441 (nucleotides) / 146 (amino acids)

Contig

Accession contig_15
Length 114235 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_107
Orthogroup size 11
N. genomes 7

Actions

Genomic region

Domains

PF06530 Phage antitermination protein Q

Protein Sequence

MRDIQIALDRWGGWASSDNCRVDYSHIAAGFKRLIVSNRSERQSCSDHDGRVIDQAITKLKAVRKDEELNLIVAHYMYGVSKRAIARKWKLSEGRIRQMIQVAEGFVDGYLYATGAVLDMDLEIEKARVINCSKKVLVRYANSVLL

Flanking regions ( +/- flanking 50bp)

GGATTGGTGTTTTTGGTTAATGCGCTGTACGGAGCGCGGAGAGATAAACGATGAGAGATATTCAGATTGCATTAGACCGCTGGGGCGGATGGGCTTCATCAGACAACTGCAGAGTGGACTACTCACACATAGCAGCAGGATTTAAAAGGCTTATCGTCAGTAACAGATCGGAGCGCCAGTCATGCAGCGATCACGATGGCCGCGTTATCGACCAGGCAATTACGAAGTTAAAAGCTGTCAGAAAAGATGAAGAGCTTAATCTGATTGTTGCTCATTACATGTATGGGGTGTCAAAACGGGCAATAGCCCGTAAATGGAAGTTAAGCGAGGGGCGTATACGACAGATGATTCAGGTTGCCGAGGGGTTTGTTGATGGTTATCTGTATGCCACTGGTGCAGTTCTTGATATGGATTTAGAGATAGAAAAAGCCAGGGTAATAAATTGCAGTAAAAAAGTATTAGTGCGCTACGCAAATTCGGTGCTACTGTGATAAGAGTGATTCCTATGTCACATTGCTTATAAACAGAAACCTCGCAATTG