Homologs in group_3752
1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| FBDBKF_12355 | FBDBKF_12355 | 53.8 | Morganella morganii S1 | - | Antitermination protein Q |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| Q9T1U3 | 2.62e-42 | 139 | 53 | 0 | 129 | 3 | 5 | Probable antitermination protein Q | Acyrthosiphon pisum secondary endosymbiont phage 1 |
| O48429 | 1.33e-27 | 102 | 45 | 2 | 125 | 3 | Q | Antitermination protein Q | Enterobacteria phage H19B |
| P68923 | 2.01e-27 | 101 | 45 | 1 | 124 | 3 | Q | Antitermination protein Q | Enterobacteria phage VT2-Sa |
| P68922 | 2.01e-27 | 101 | 45 | 1 | 124 | 3 | Q | Antitermination protein Q | Escherichia phage 933W |
| Q47274 | 1.3e-25 | 96 | 44 | 2 | 122 | 3 | quuD | Prophage antitermination protein Q homolog QuuD | Escherichia coli (strain K12) |
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS04675 |
| Feature type | CDS |
| Gene | - |
| Product | antiterminator Q family protein |
| Location | 1033009 - 1033407 (strand: 1) |
| Length | 399 (nucleotides) / 132 (amino acids) |
| In genomic island | GI56 |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_3752 | |
|---|---|---|
| Orthogroup size | 2 | |
| N. genomes | 2 |
| PF06530 | Phage antitermination protein Q |
|---|
MRDIQQVLERWGAWASDVQSGVDYSHIAAGFKGVLPYQSSSRISCCDDDGMIIDATIARLQQLRREEELNALILHYIYQCSKRSIARRWKVSESRVRQIIQIAEGFVEGGLAMLDSGLVMDHEVACNKKQVK
TAATTGCTCGTTCAACAATTACAGATAAGATCGCATAAGGTAGTGGTGATATGAGAGATATACAACAAGTATTAGAACGATGGGGAGCTTGGGCCTCGGATGTACAAAGTGGAGTAGATTATTCTCATATTGCAGCAGGTTTTAAGGGTGTTTTACCTTATCAATCATCTTCAAGGATAAGTTGTTGTGATGATGATGGTATGATTATTGACGCTACAATAGCGCGATTACAACAATTGAGAAGAGAAGAAGAATTGAATGCGCTTATTTTACATTATATATATCAGTGCTCTAAAAGAAGCATTGCAAGACGTTGGAAGGTGAGTGAAAGCCGTGTACGTCAGATTATACAGATTGCAGAAGGTTTTGTAGAAGGTGGTTTGGCGATGTTAGATTCAGGATTAGTCATGGATCATGAAGTTGCTTGTAATAAAAAACAGGTTAAATAAAAAAGTATTAACGCGCTACGCAAATTAACTGTTATTCTAATAAAAATAAA
