Homologs in group_3316

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_05325 EHELCC_05325 100.0 Morganella morganii S2 ydcZ DUF606 domain-containing protein
NLDBIP_05645 NLDBIP_05645 100.0 Morganella morganii S4 ydcZ DUF606 domain-containing protein
LHKJJB_02525 LHKJJB_02525 100.0 Morganella morganii S3 ydcZ DUF606 domain-containing protein
HKOGLL_15905 HKOGLL_15905 100.0 Morganella morganii S5 ydcZ DUF606 domain-containing protein

Distribution of the homologs in the orthogroup group_3316

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3316

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_10900
Feature type CDS
Gene ydcZ
Product DUF606 domain-containing protein
Location 8069 - 8497 (strand: -1)
Length 429 (nucleotides) / 142 (amino acids)
In genomic island -

Contig

Accession contig_13
Length 135581 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3316
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF04657 Putative inner membrane exporter, YdcZ

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3238 Function unknown (S) S Uncharacterized membrane protein YdcZ, DUF606 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09936 bacterial/archaeal transporter family-2 protein Quorum sensing -

Protein Sequence

MMLLFYITIALTNGICIIFSRSINGRLSQSSNAFYASLVNHIAGFIFLSVVVLFYLPQFPVTLNSIPLITFTGGIIGACFVVINSYILPLLGATLTTILAICGQVLSGFIIDIIQHGMPSHLLMQITGVILILLAIAVRYRK

Flanking regions ( +/- flanking 50bp)

ACACTGCTGCTGTTATTCAGCGGCTGTATTTTGATCATTGCAGGAAAATAATGATGTTACTGTTTTATATTACTATCGCGCTGACAAATGGCATTTGTATTATTTTCAGCCGCAGTATTAACGGCAGATTATCTCAGAGCAGCAATGCGTTTTATGCCTCGCTGGTTAATCATATTGCCGGTTTTATCTTTCTGAGTGTGGTTGTACTGTTTTACCTGCCGCAGTTCCCCGTCACACTGAACAGTATTCCGCTGATTACATTCACCGGCGGTATTATCGGTGCCTGTTTCGTGGTGATAAACAGTTATATTCTGCCGCTGCTCGGCGCCACACTGACCACCATTCTGGCTATCTGCGGCCAGGTATTATCCGGCTTTATTATCGATATCATACAGCACGGCATGCCGTCACATCTGCTGATGCAGATAACCGGTGTCATCTTAATCCTGCTGGCTATCGCTGTCCGCTACCGGAAGTAATTTTTCTTATTTCGTTACTCAGCGAAGTGTTTTCTCTGTGCTTCCGATAT