Homologs in group_1563

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_04935 EHELCC_04935 100.0 Morganella morganii S2 mnmH tRNA 2-selenouridine(34) synthase MnmH
NLDBIP_04935 NLDBIP_04935 100.0 Morganella morganii S4 mnmH tRNA 2-selenouridine(34) synthase MnmH
LHKJJB_13695 LHKJJB_13695 100.0 Morganella morganii S3 mnmH tRNA 2-selenouridine(34) synthase MnmH
HKOGLL_12840 HKOGLL_12840 100.0 Morganella morganii S5 mnmH tRNA 2-selenouridine(34) synthase MnmH
F4V73_RS00205 F4V73_RS00205 83.3 Morganella psychrotolerans mnmH tRNA 2-selenouridine(34) synthase MnmH
PMI_RS06095 PMI_RS06095 71.9 Proteus mirabilis HI4320 mnmH tRNA 2-selenouridine(34) synthase MnmH

Distribution of the homologs in the orthogroup group_1563

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1563

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F2U3 0.0 551 72 0 359 3 selU tRNA 2-selenouridine synthase Proteus mirabilis (strain HI4320)
B5BD19 2.55e-173 489 66 1 362 3 selU tRNA 2-selenouridine synthase Salmonella paratyphi A (strain AKU_12601)
Q5PCH1 2.55e-173 489 66 1 362 3 selU tRNA 2-selenouridine synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5QUA2 4.35e-173 488 66 1 362 3 selU tRNA 2-selenouridine synthase Salmonella enteritidis PT4 (strain P125109)
Q8ZR88 4.75e-173 488 66 1 362 1 selU tRNA 2-selenouridine synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5R637 6.89e-173 488 66 1 362 3 selU tRNA 2-selenouridine synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B4TMJ2 7.96e-173 488 68 1 352 3 selU tRNA 2-selenouridine synthase Salmonella schwarzengrund (strain CVM19633)
B7MQL5 1.15e-172 487 65 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O81 (strain ED1a)
B7N958 1.79e-172 487 64 1 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q32J96 3.12e-172 486 64 1 362 3 selU tRNA 2-selenouridine synthase Shigella dysenteriae serotype 1 (strain Sd197)
B1LKC2 3.22e-172 486 64 1 362 3 selU tRNA 2-selenouridine synthase Escherichia coli (strain SMS-3-5 / SECEC)
C0PVG5 3.56e-172 486 66 1 362 3 selU tRNA 2-selenouridine synthase Salmonella paratyphi C (strain RKS4594)
B4SXL9 3.56e-172 486 66 1 362 3 selU tRNA 2-selenouridine synthase Salmonella newport (strain SL254)
Q57S51 3.56e-172 486 66 1 362 3 selU tRNA 2-selenouridine synthase Salmonella choleraesuis (strain SC-B67)
B5YPM0 4.28e-172 486 65 1 357 3 selU tRNA 2-selenouridine synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCZ2 4.28e-172 486 65 1 357 3 selU tRNA 2-selenouridine synthase Escherichia coli O157:H7
Q8Z8R4 6.15e-172 486 66 1 362 3 selU tRNA 2-selenouridine synthase Salmonella typhi
Q324Z4 6.93e-172 485 64 1 362 3 selU tRNA 2-selenouridine synthase Shigella boydii serotype 4 (strain Sb227)
B2TTA2 6.93e-172 485 64 1 362 3 selU tRNA 2-selenouridine synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1IZ97 8.44e-172 485 65 1 357 3 selU tRNA 2-selenouridine synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZXF7 8.44e-172 485 65 1 357 3 selU tRNA 2-selenouridine synthase Escherichia coli O9:H4 (strain HS)
B5FLM4 8.82e-172 485 66 1 362 3 selU tRNA 2-selenouridine synthase Salmonella dublin (strain CT_02021853)
P33667 1.49e-171 484 64 1 362 1 selU tRNA 2-selenouridine synthase Escherichia coli (strain K12)
B1XFT8 1.49e-171 484 64 1 362 3 selU tRNA 2-selenouridine synthase Escherichia coli (strain K12 / DH10B)
C4ZUV3 1.49e-171 484 64 1 362 3 selU tRNA 2-selenouridine synthase Escherichia coli (strain K12 / MC4100 / BW2952)
A9MLB3 1.54e-171 484 67 1 350 3 selU tRNA 2-selenouridine synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q9S4Y8 1.78e-171 484 66 1 362 3 selU tRNA 2-selenouridine synthase Salmonella enteritidis
B5EYB4 1.9e-171 484 66 1 362 3 selU tRNA 2-selenouridine synthase Salmonella agona (strain SL483)
B6I0F4 2.28e-171 484 65 1 357 3 selU tRNA 2-selenouridine synthase Escherichia coli (strain SE11)
Q0TKD8 2.44e-171 484 64 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A9MW55 3e-171 484 66 1 362 3 selU tRNA 2-selenouridine synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q3Z4Q0 6.39e-171 483 65 1 357 3 selU tRNA 2-selenouridine synthase Shigella sonnei (strain Ss046)
Q1RF31 6.39e-171 483 64 1 362 3 selU tRNA 2-selenouridine synthase Escherichia coli (strain UTI89 / UPEC)
A1A8G9 6.39e-171 483 64 1 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O1:K1 / APEC
B7ME26 6.39e-171 483 64 1 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7L7D0 6.97e-171 483 64 1 357 3 selU tRNA 2-selenouridine synthase Escherichia coli (strain 55989 / EAEC)
B4T9K6 1.12e-170 482 66 1 362 3 selU tRNA 2-selenouridine synthase Salmonella heidelberg (strain SL476)
Q0T790 1.57e-170 482 64 1 362 3 selU tRNA 2-selenouridine synthase Shigella flexneri serotype 5b (strain 8401)
B7M4K7 1.75e-170 482 64 1 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O8 (strain IAI1)
B7LJH5 2.45e-170 481 64 1 362 3 selU tRNA 2-selenouridine synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q83SD5 3.72e-170 481 64 1 362 3 selU tRNA 2-selenouridine synthase Shigella flexneri
B7UKI1 4.43e-170 481 64 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZIR0 7.17e-170 480 64 1 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8FK67 3.53e-168 476 65 2 354 3 selU tRNA 2-selenouridine synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8GFD0 3.73e-152 436 61 1 350 3 selU tRNA 2-selenouridine synthase Serratia proteamaculans (strain 568)
A7MJZ3 4.74e-140 405 63 2 362 3 selU tRNA 2-selenouridine synthase Cronobacter sakazakii (strain ATCC BAA-894)
Q6LP06 2.24e-135 393 53 1 352 3 selU tRNA 2-selenouridine synthase Photobacterium profundum (strain SS9)
Q488J6 4.23e-120 354 50 2 355 3 selU tRNA 2-selenouridine synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A3Q958 8.8e-118 348 48 3 359 3 selU tRNA 2-selenouridine synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B8CH52 9.39e-116 343 47 2 356 3 selU tRNA 2-selenouridine synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
B1KN07 1.97e-115 342 45 2 353 3 selU tRNA 2-selenouridine synthase Shewanella woodyi (strain ATCC 51908 / MS32)
B0TMW0 5.78e-115 341 46 2 351 3 selU tRNA 2-selenouridine synthase Shewanella halifaxensis (strain HAW-EB4)
A8GYV2 2.38e-114 339 46 2 351 3 selU tRNA 2-selenouridine synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A8G1H1 2.44e-114 340 45 3 359 3 selU tRNA 2-selenouridine synthase Shewanella sediminis (strain HAW-EB3)
A1SRN6 8.19e-113 335 46 1 349 3 selU tRNA 2-selenouridine synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q1IEL0 9.55e-113 335 47 2 360 3 selU tRNA 2-selenouridine synthase Pseudomonas entomophila (strain L48)
Q089T3 9.75e-113 335 45 3 360 3 selU tRNA 2-selenouridine synthase Shewanella frigidimarina (strain NCIMB 400)
B0KPF4 9.8e-112 333 48 3 361 3 selU tRNA 2-selenouridine synthase Pseudomonas putida (strain GB-1)
Q8EKA0 7.65e-111 331 45 2 351 3 selU tRNA 2-selenouridine synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B1JDU1 7.91e-111 330 49 3 354 3 selU tRNA 2-selenouridine synthase Pseudomonas putida (strain W619)
A6WHQ4 1.06e-110 330 45 2 351 3 selU tRNA 2-selenouridine synthase Shewanella baltica (strain OS185)
A1RP95 2.27e-110 329 45 2 352 3 selU tRNA 2-selenouridine synthase Shewanella sp. (strain W3-18-1)
A4YBC0 2.27e-110 329 45 2 352 3 selU tRNA 2-selenouridine synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KW78 1.98e-109 327 45 2 351 3 selU tRNA 2-selenouridine synthase Shewanella baltica (strain OS195)
A5VYQ1 4.2e-109 326 47 3 361 3 selU tRNA 2-selenouridine synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88PM7 5.57e-109 326 47 3 361 3 selU tRNA 2-selenouridine synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A3DA85 1.17e-108 325 45 2 351 3 selU tRNA 2-selenouridine synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q48NL9 1.4e-108 325 45 2 360 3 selU tRNA 2-selenouridine synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A1U6R9 1.47e-108 325 45 2 360 3 selU tRNA 2-selenouridine synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q0I0D0 1.99e-108 324 45 3 360 3 selU tRNA 2-selenouridine synthase Shewanella sp. (strain MR-7)
Q0HNW2 2.35e-108 325 46 2 349 3 selU tRNA 2-selenouridine synthase Shewanella sp. (strain MR-4)
B8EBN0 6.5e-108 323 45 2 351 3 selU tRNA 2-selenouridine synthase Shewanella baltica (strain OS223)
Q4ZYK5 6.87e-108 323 45 2 360 3 selU tRNA 2-selenouridine synthase Pseudomonas syringae pv. syringae (strain B728a)
Q4KEE7 8.54e-108 323 47 3 352 3 selU tRNA 2-selenouridine synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q889F6 5.73e-107 321 46 2 359 3 selU tRNA 2-selenouridine synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q12SQ2 7.19e-107 320 45 3 360 3 selU tRNA 2-selenouridine synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A0KRK0 9.76e-107 320 45 3 360 3 selU tRNA 2-selenouridine synthase Shewanella sp. (strain ANA-3)
Q3K9R2 3.48e-106 318 48 4 353 3 selU tRNA 2-selenouridine synthase Pseudomonas fluorescens (strain Pf0-1)
A9I3Z9 6.66e-106 318 45 3 358 3 selU tRNA 2-selenouridine synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A0KKE6 1.11e-105 317 46 2 361 3 selU tRNA 2-selenouridine synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q0KEU1 1.63e-105 317 46 2 360 3 selU tRNA 2-selenouridine synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B7UV78 1.8e-105 317 47 3 358 3 selU tRNA 2-selenouridine synthase Pseudomonas aeruginosa (strain LESB58)
Q9I382 3.48e-105 316 47 3 358 3 selU tRNA 2-selenouridine synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02KC8 3.48e-105 316 47 3 358 3 selU tRNA 2-selenouridine synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V7E9 7.54e-105 315 47 3 358 3 selU tRNA 2-selenouridine synthase Pseudomonas aeruginosa (strain PA7)
Q476K0 2.84e-104 314 47 3 354 3 selU tRNA 2-selenouridine synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
C1DNN5 8.88e-104 313 47 3 351 3 selU tRNA 2-selenouridine synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A1S1Z4 2.1e-103 311 44 2 355 3 selU tRNA 2-selenouridine synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q7WE96 2.69e-103 311 47 3 358 3 selU tRNA 2-selenouridine synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A6QBB6 3.18e-102 308 44 4 363 3 selU tRNA 2-selenouridine synthase Sulfurovum sp. (strain NBC37-1)
A4XV44 6.91e-102 308 47 3 353 3 selU tRNA 2-selenouridine synthase Pseudomonas mendocina (strain ymp)
B2AGP0 4.03e-100 303 46 2 359 3 selU tRNA 2-selenouridine synthase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A4SMM2 5.38e-99 300 44 2 361 3 selU tRNA 2-selenouridine synthase Aeromonas salmonicida (strain A449)
Q2SQB9 8.96e-98 298 45 3 351 3 selU tRNA 2-selenouridine synthase Hahella chejuensis (strain KCTC 2396)
A1WIC3 1.04e-97 297 46 3 354 3 selU tRNA 2-selenouridine synthase Verminephrobacter eiseniae (strain EF01-2)
Q30RE2 1.31e-94 289 42 4 354 3 selU tRNA 2-selenouridine synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q31GV5 1.7e-89 276 41 3 364 3 selU tRNA 2-selenouridine synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q1R084 2.33e-87 270 45 2 338 3 selU tRNA 2-selenouridine synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0VNT0 2.6e-86 268 44 2 351 3 selU tRNA 2-selenouridine synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q82WE9 1.01e-82 259 37 6 376 3 selU tRNA 2-selenouridine synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q0AFI5 3.79e-74 237 36 8 376 3 selU tRNA 2-selenouridine synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q6MK43 6.51e-74 236 38 8 362 3 selU tRNA 2-selenouridine synthase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q60359 4.98e-15 76 31 2 135 4 MJ0052 Uncharacterized protein MJ0052 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_10135
Feature type CDS
Gene mnmH
Product tRNA 2-selenouridine(34) synthase MnmH
Location 117352 - 118434 (strand: -1)
Length 1083 (nucleotides) / 360 (amino acids)

Contig

Accession contig_11
Length 143616 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1563
Orthogroup size 7
N. genomes 7

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2603 Translation, ribosomal structure and biogenesis (J) J tRNA 2-selenouridine synthase SelU, contains rhodanese domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06917 tRNA 2-selenouridine synthase [EC:2.9.1.3] - -

Protein Sequence

MELAPSSRTIRTLLASDTPLIDVRAPVEFCQGAMPASHNLPLMNDEERAAVGTCYKQQGAEKALALGYQLVNGERREQRIAAWLAACADYPQGYLCCARGGQRSHIVQQWLRDAGTEYPLITGGYKALRQAVIQVTEELVARPVILIGGCTGSGKTTLVGELADGIDLEGLAHHRGSSFGRTLEAQFAQATFENHLAAAMIKKENAGTRWVLEDEGRAIGANGLPEPLRVQMAQASLVVVEDPFERRLERLKEEYFDRMTHDFTAAYGEEKGREAYSEYLHHGLSAIRRRLGTQRAAELTALLDSALAEQWRSGNTEAHFSWLCPLLEEYYDPMYRYQLSKKADRILFRGTYEAVADWLK

Flanking regions ( +/- flanking 50bp)

TTGCAGACAGCTGAATTTATTGGCATCTGAACTGAAATCACACATTTATTATGGAATTAGCTCCGTCTTCCCGAACTATCCGCACACTCCTTGCTTCTGATACACCGCTGATTGATGTCCGCGCACCGGTTGAATTCTGCCAGGGAGCCATGCCTGCCTCACACAATCTGCCGCTGATGAATGATGAGGAGCGGGCCGCTGTCGGCACCTGTTATAAGCAGCAAGGCGCTGAAAAGGCGCTGGCGCTGGGGTATCAGCTGGTAAACGGTGAGCGCCGTGAACAGCGGATAGCAGCCTGGCTGGCGGCCTGTGCGGATTATCCGCAGGGCTATCTCTGCTGTGCCCGGGGCGGCCAGCGTTCACATATCGTGCAGCAGTGGCTGCGGGATGCGGGAACGGAATACCCGCTGATCACCGGCGGTTACAAAGCACTGCGTCAGGCGGTAATTCAGGTGACGGAAGAGCTGGTGGCGCGTCCGGTGATCCTGATCGGCGGCTGTACCGGCAGCGGTAAAACCACGCTGGTGGGCGAACTGGCGGACGGTATCGACCTGGAAGGACTGGCGCATCACCGCGGATCGTCTTTCGGGCGCACCTTGGAGGCGCAGTTTGCCCAGGCAACATTTGAAAATCATCTCGCTGCCGCGATGATAAAAAAAGAAAACGCCGGAACCCGCTGGGTGCTGGAGGATGAAGGCCGCGCCATCGGTGCTAACGGCCTGCCGGAGCCGCTGCGGGTACAAATGGCACAGGCTTCGCTGGTGGTGGTGGAAGATCCGTTTGAGCGCCGTCTGGAACGGCTGAAAGAAGAATATTTTGACCGCATGACTCATGATTTCACCGCCGCATACGGTGAGGAAAAGGGGCGTGAGGCATACAGTGAGTATCTGCATCACGGGCTGTCAGCTATCCGGCGGCGGCTCGGCACGCAGCGGGCGGCGGAACTGACCGCGCTGCTCGACAGTGCACTTGCCGAGCAGTGGCGCAGCGGCAATACCGAAGCTCACTTCTCGTGGCTGTGTCCGCTGCTGGAAGAATATTACGACCCGATGTACCGCTATCAGCTGAGCAAAAAAGCCGACCGCATCCTCTTTCGCGGCACCTATGAAGCCGTCGCTGACTGGCTGAAATAATCCGCCGTCTCATCATTCGTCACAAAGCTGTTCACCGGGGTATCATTTTC