Homologs in group_1611

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10135 FBDBKF_10135 83.3 Morganella morganii S1 mnmH tRNA 2-selenouridine(34) synthase MnmH
EHELCC_04935 EHELCC_04935 83.3 Morganella morganii S2 mnmH tRNA 2-selenouridine(34) synthase MnmH
NLDBIP_04935 NLDBIP_04935 83.3 Morganella morganii S4 mnmH tRNA 2-selenouridine(34) synthase MnmH
LHKJJB_13695 LHKJJB_13695 83.3 Morganella morganii S3 mnmH tRNA 2-selenouridine(34) synthase MnmH
HKOGLL_12840 HKOGLL_12840 83.3 Morganella morganii S5 mnmH tRNA 2-selenouridine(34) synthase MnmH
PMI_RS06095 PMI_RS06095 71.1 Proteus mirabilis HI4320 mnmH tRNA 2-selenouridine(34) synthase MnmH

Distribution of the homologs in the orthogroup group_1611

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1611

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F2U3 0.0 545 71 0 359 3 selU tRNA 2-selenouridine synthase Proteus mirabilis (strain HI4320)
B7N958 7.19e-175 493 64 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1IZ97 2.29e-174 492 64 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZXF7 2.29e-174 492 64 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O9:H4 (strain HS)
Q324Z4 4.1e-174 491 64 2 362 3 selU tRNA 2-selenouridine synthase Shigella boydii serotype 4 (strain Sb227)
B2TTA2 4.1e-174 491 64 2 362 3 selU tRNA 2-selenouridine synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q0T790 9.2e-174 490 64 2 362 3 selU tRNA 2-selenouridine synthase Shigella flexneri serotype 5b (strain 8401)
B5YPM0 2.33e-173 489 64 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCZ2 2.33e-173 489 64 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O157:H7
Q83SD5 2.36e-173 489 64 2 362 3 selU tRNA 2-selenouridine synthase Shigella flexneri
Q32J96 2.38e-173 489 64 2 362 3 selU tRNA 2-selenouridine synthase Shigella dysenteriae serotype 1 (strain Sd197)
B1LKC2 2.81e-173 489 64 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli (strain SMS-3-5 / SECEC)
B6I0F4 3.1e-173 489 64 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli (strain SE11)
B7L7D0 3.73e-173 489 64 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli (strain 55989 / EAEC)
Q3Z4Q0 6.89e-173 488 64 2 362 3 selU tRNA 2-selenouridine synthase Shigella sonnei (strain Ss046)
B7M4K7 7.12e-173 488 64 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O8 (strain IAI1)
B7MQL5 1.34e-172 487 63 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O81 (strain ED1a)
P33667 1.4e-172 487 63 2 362 1 selU tRNA 2-selenouridine synthase Escherichia coli (strain K12)
B1XFT8 1.4e-172 487 63 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli (strain K12 / DH10B)
C4ZUV3 1.4e-172 487 63 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LJH5 1.45e-172 487 64 2 362 3 selU tRNA 2-selenouridine synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A7ZIR0 2.68e-172 486 63 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q1RF31 1.32e-171 484 63 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli (strain UTI89 / UPEC)
A1A8G9 1.32e-171 484 63 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O1:K1 / APEC
B7ME26 1.32e-171 484 63 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0TKD8 1.34e-171 484 63 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UKI1 1.54e-171 484 63 2 362 3 selU tRNA 2-selenouridine synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5QUA2 9.68e-171 483 65 1 355 3 selU tRNA 2-selenouridine synthase Salmonella enteritidis PT4 (strain P125109)
B5R637 1.22e-170 482 65 1 355 3 selU tRNA 2-selenouridine synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q8ZR88 2.83e-170 481 65 1 355 1 selU tRNA 2-selenouridine synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BD19 2.86e-170 481 65 1 355 3 selU tRNA 2-selenouridine synthase Salmonella paratyphi A (strain AKU_12601)
Q5PCH1 2.86e-170 481 65 1 355 3 selU tRNA 2-selenouridine synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TMJ2 6.3e-170 480 65 1 352 3 selU tRNA 2-selenouridine synthase Salmonella schwarzengrund (strain CVM19633)
C0PVG5 2.12e-169 479 65 1 355 3 selU tRNA 2-selenouridine synthase Salmonella paratyphi C (strain RKS4594)
B4SXL9 2.12e-169 479 65 1 355 3 selU tRNA 2-selenouridine synthase Salmonella newport (strain SL254)
Q57S51 2.12e-169 479 65 1 355 3 selU tRNA 2-selenouridine synthase Salmonella choleraesuis (strain SC-B67)
Q8Z8R4 2.72e-169 479 65 1 355 3 selU tRNA 2-selenouridine synthase Salmonella typhi
B5FLM4 3.01e-169 479 65 1 355 3 selU tRNA 2-selenouridine synthase Salmonella dublin (strain CT_02021853)
B5EYB4 3.14e-169 479 65 1 355 3 selU tRNA 2-selenouridine synthase Salmonella agona (strain SL483)
Q9S4Y8 3.28e-169 479 65 1 355 3 selU tRNA 2-selenouridine synthase Salmonella enteritidis
A9MLB3 7.39e-169 478 65 1 350 3 selU tRNA 2-selenouridine synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A9MW55 2.62e-168 476 65 1 355 3 selU tRNA 2-selenouridine synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T9K6 4.29e-168 476 65 1 355 3 selU tRNA 2-selenouridine synthase Salmonella heidelberg (strain SL476)
Q8FK67 6.38e-168 475 63 2 354 3 selU tRNA 2-selenouridine synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8GFD0 5.01e-142 410 57 1 353 3 selU tRNA 2-selenouridine synthase Serratia proteamaculans (strain 568)
A7MJZ3 4.74e-138 400 62 2 362 3 selU tRNA 2-selenouridine synthase Cronobacter sakazakii (strain ATCC BAA-894)
Q6LP06 1.23e-135 394 53 1 353 3 selU tRNA 2-selenouridine synthase Photobacterium profundum (strain SS9)
Q488J6 2.91e-125 367 52 2 352 3 selU tRNA 2-selenouridine synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B8CH52 4.64e-111 331 45 2 356 3 selU tRNA 2-selenouridine synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
A1SRN6 3.79e-110 328 45 1 352 3 selU tRNA 2-selenouridine synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A8GYV2 1.49e-109 327 43 3 362 3 selU tRNA 2-selenouridine synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TMW0 9.49e-109 325 43 2 351 3 selU tRNA 2-selenouridine synthase Shewanella halifaxensis (strain HAW-EB4)
A8G1H1 1.42e-107 322 43 2 351 3 selU tRNA 2-selenouridine synthase Shewanella sediminis (strain HAW-EB3)
A1RP95 1.57e-107 322 44 2 352 3 selU tRNA 2-selenouridine synthase Shewanella sp. (strain W3-18-1)
A4YBC0 1.57e-107 322 44 2 352 3 selU tRNA 2-selenouridine synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B1KN07 2.98e-107 322 42 2 353 3 selU tRNA 2-selenouridine synthase Shewanella woodyi (strain ATCC 51908 / MS32)
A3Q958 4.5e-107 321 45 2 349 3 selU tRNA 2-selenouridine synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A6WHQ4 5.13e-107 321 44 2 351 3 selU tRNA 2-selenouridine synthase Shewanella baltica (strain OS185)
B0KPF4 1.41e-106 320 47 3 361 3 selU tRNA 2-selenouridine synthase Pseudomonas putida (strain GB-1)
A9I3Z9 1.75e-106 320 47 3 353 3 selU tRNA 2-selenouridine synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q1IEL0 5.2e-106 318 46 2 360 3 selU tRNA 2-selenouridine synthase Pseudomonas entomophila (strain L48)
B1JDU1 8.87e-106 318 48 3 354 3 selU tRNA 2-selenouridine synthase Pseudomonas putida (strain W619)
A3DA85 2.14e-105 317 44 2 351 3 selU tRNA 2-selenouridine synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A9KW78 3.03e-105 316 44 2 351 3 selU tRNA 2-selenouridine synthase Shewanella baltica (strain OS195)
Q48NL9 3.16e-105 316 44 2 360 3 selU tRNA 2-selenouridine synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B8EBN0 3.45e-105 316 44 2 351 3 selU tRNA 2-selenouridine synthase Shewanella baltica (strain OS223)
Q88PM7 4.47e-105 316 46 3 361 3 selU tRNA 2-selenouridine synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VYQ1 4.62e-105 316 46 3 361 3 selU tRNA 2-selenouridine synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A1S1Z4 1.13e-104 315 44 3 358 3 selU tRNA 2-selenouridine synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q4KEE7 1.32e-104 315 46 3 352 3 selU tRNA 2-selenouridine synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B7UV78 1.86e-104 314 47 3 358 3 selU tRNA 2-selenouridine synthase Pseudomonas aeruginosa (strain LESB58)
Q4ZYK5 3.07e-104 313 44 2 360 3 selU tRNA 2-selenouridine synthase Pseudomonas syringae pv. syringae (strain B728a)
Q9I382 3.77e-104 313 47 3 358 3 selU tRNA 2-selenouridine synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02KC8 3.77e-104 313 47 3 358 3 selU tRNA 2-selenouridine synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q089T3 4.54e-104 313 43 3 360 3 selU tRNA 2-selenouridine synthase Shewanella frigidimarina (strain NCIMB 400)
Q0I0D0 8.89e-104 313 43 3 360 3 selU tRNA 2-selenouridine synthase Shewanella sp. (strain MR-7)
A0KRK0 1.57e-103 312 43 3 360 3 selU tRNA 2-selenouridine synthase Shewanella sp. (strain ANA-3)
A1U6R9 1.99e-103 311 43 2 362 3 selU tRNA 2-selenouridine synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q0HNW2 2.05e-103 312 43 3 360 3 selU tRNA 2-selenouridine synthase Shewanella sp. (strain MR-4)
Q889F6 2.97e-103 311 44 2 359 3 selU tRNA 2-selenouridine synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8EKA0 7.77e-103 310 42 2 354 3 selU tRNA 2-selenouridine synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q12SQ2 3.39e-102 308 43 3 360 3 selU tRNA 2-selenouridine synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q0KEU1 5.65e-102 308 44 2 360 3 selU tRNA 2-selenouridine synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A0KKE6 8.26e-102 307 44 2 361 3 selU tRNA 2-selenouridine synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A6V7E9 1.57e-101 307 46 3 358 3 selU tRNA 2-selenouridine synthase Pseudomonas aeruginosa (strain PA7)
Q7WE96 2.12e-99 301 46 3 356 3 selU tRNA 2-selenouridine synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
C1DNN5 8.23e-99 300 45 3 351 3 selU tRNA 2-selenouridine synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q3K9R2 1.42e-98 299 45 4 353 3 selU tRNA 2-selenouridine synthase Pseudomonas fluorescens (strain Pf0-1)
A4XV44 2.95e-98 298 46 3 353 3 selU tRNA 2-selenouridine synthase Pseudomonas mendocina (strain ymp)
A6QBB6 5.53e-98 298 42 4 363 3 selU tRNA 2-selenouridine synthase Sulfurovum sp. (strain NBC37-1)
Q476K0 6.35e-98 298 44 3 354 3 selU tRNA 2-selenouridine synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A1WIC3 5.68e-96 293 45 3 354 3 selU tRNA 2-selenouridine synthase Verminephrobacter eiseniae (strain EF01-2)
Q2SQB9 5.16e-95 291 44 3 351 3 selU tRNA 2-selenouridine synthase Hahella chejuensis (strain KCTC 2396)
B2AGP0 7.99e-95 290 43 2 359 3 selU tRNA 2-selenouridine synthase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A4SMM2 1.66e-94 289 41 2 361 3 selU tRNA 2-selenouridine synthase Aeromonas salmonicida (strain A449)
Q1R084 6.49e-92 282 45 2 347 3 selU tRNA 2-selenouridine synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q30RE2 3.91e-91 280 40 4 354 3 selU tRNA 2-selenouridine synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q31GV5 9.11e-87 269 42 4 364 3 selU tRNA 2-selenouridine synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q0VNT0 1.24e-84 263 43 2 351 3 selU tRNA 2-selenouridine synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q82WE9 9.35e-81 254 38 6 375 3 selU tRNA 2-selenouridine synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q6MK43 1.27e-75 241 38 7 369 3 selU tRNA 2-selenouridine synthase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q0AFI5 1.35e-72 233 36 6 370 3 selU tRNA 2-selenouridine synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q60359 9.15e-19 87 33 2 135 4 MJ0052 Uncharacterized protein MJ0052 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS00205
Feature type CDS
Gene mnmH
Product tRNA 2-selenouridine(34) synthase MnmH
Location 52865 - 53947 (strand: 1)
Length 1083 (nucleotides) / 360 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1611
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00581 Rhodanese-like domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2603 Translation, ribosomal structure and biogenesis (J) J tRNA 2-selenouridine synthase SelU, contains rhodanese domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06917 tRNA 2-selenouridine synthase [EC:2.9.1.3] - -

Protein Sequence

MELAPSPQTIRTLLATEVPLIDVRAPVEFNQGAMPGALNLPLMNDEERAAVGTCYKQQGSEKALALGYHLVSGESRARRLADWQDLCTRNPQGYLCCARGGQRSHIVQQWLHESGIEYPLITGGYKALRQAVIQVTAELVQRPVILIGGCTGNGKTTLVGELADGIDLEGLAHHRGSSFGRTLEAQFAQATFENHLAAVMVKKETGRMRWVLEDEGRAIGVNGLPDCLRAQMEQASLVVVDDPLERRLERLKEEYFDRMYRDFTAAYGEEQGWLAYSEYLHHGLSAIRKRLGTQRAADLTALLDTALAEQLRTGVTDAHFSWLCPLLAEYYDPMYRYQLSKKTDRILFNGTYDEVADWLK

Flanking regions ( +/- flanking 50bp)

CACCGGCGGATCTTTTCACCGACATCTGAGTTGAAATCACAGTTTTTATTATGGAATTAGCCCCGTCTCCCCAAACAATCCGTACTCTCCTTGCCACTGAAGTTCCGTTGATTGACGTCCGTGCGCCGGTGGAATTTAACCAGGGCGCGATGCCCGGTGCGCTTAATTTGCCGCTGATGAATGATGAAGAGCGCGCGGCGGTCGGCACCTGTTATAAACAGCAAGGCTCTGAGAAAGCACTCGCGCTGGGTTATCACCTGGTCAGCGGTGAAAGCCGTGCCCGCCGTCTGGCGGACTGGCAGGACTTGTGTACCCGCAATCCGCAGGGCTACCTTTGCTGTGCGCGCGGTGGTCAGCGTTCTCATATTGTGCAGCAGTGGCTGCATGAGTCGGGTATTGAATACCCGCTGATTACCGGCGGCTATAAAGCCCTGCGCCAGGCCGTGATTCAGGTAACCGCTGAGCTGGTACAGCGCCCGGTGATATTAATCGGCGGCTGTACCGGCAACGGCAAAACCACGCTGGTGGGGGAACTGGCAGACGGTATTGATCTGGAAGGACTGGCACATCACCGTGGTTCCTCATTCGGACGAACCCTGGAAGCCCAGTTTGCACAGGCGACCTTTGAGAACCATCTCGCAGCCGTAATGGTAAAAAAAGAAACCGGGCGGATGCGCTGGGTACTGGAAGATGAAGGCCGGGCAATCGGCGTCAATGGTCTGCCGGACTGTCTGCGGGCGCAGATGGAGCAGGCATCCCTGGTGGTGGTGGACGATCCGCTTGAGCGGCGCCTGGAACGGCTGAAAGAAGAGTATTTCGATCGCATGTACCGGGATTTTACGGCGGCTTACGGTGAAGAGCAGGGCTGGCTGGCATACAGTGAGTATCTGCATCACGGACTGTCAGCTATCCGCAAACGCCTTGGCACACAGCGGGCTGCGGATCTTACCGCATTGCTGGACACCGCGCTGGCAGAACAATTGCGCACGGGTGTTACCGACGCGCATTTCTCCTGGTTGTGCCCGTTACTGGCAGAATATTATGACCCGATGTACCGCTATCAGCTCAGCAAAAAAACAGACCGGATACTTTTTAACGGCACCTATGACGAGGTCGCTGACTGGCTTAAATAATTAGCGGGCTGCACTCAGCTCGCCCGCATCCGAATAGTTCAGAGTATTAA