Homologs in group_1560

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_04905 EHELCC_04905 100.0 Morganella morganii S2 lipB lipoyl(octanoyl) transferase LipB
NLDBIP_04905 NLDBIP_04905 100.0 Morganella morganii S4 lipB lipoyl(octanoyl) transferase LipB
LHKJJB_13725 LHKJJB_13725 100.0 Morganella morganii S3 lipB lipoyl(octanoyl) transferase LipB
HKOGLL_12810 HKOGLL_12810 100.0 Morganella morganii S5 lipB lipoyl(octanoyl) transferase LipB
F4V73_RS00230 F4V73_RS00230 92.9 Morganella psychrotolerans lipB lipoyl(octanoyl) transferase LipB
PMI_RS02075 PMI_RS02075 67.9 Proteus mirabilis HI4320 lipB lipoyl(octanoyl) transferase LipB

Distribution of the homologs in the orthogroup group_1560

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1560

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q66DF4 2e-114 328 75 0 208 3 lipB Octanoyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TP08 2e-114 328 75 0 208 3 lipB Octanoyltransferase Yersinia pestis (strain Pestoides F)
Q1CKR5 2e-114 328 75 0 208 3 lipB Octanoyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZDG9 2e-114 328 75 0 208 3 lipB Octanoyltransferase Yersinia pestis
B2K875 2e-114 328 75 0 208 3 lipB Octanoyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C508 2e-114 328 75 0 208 3 lipB Octanoyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKY8 2.57e-114 328 74 0 208 3 lipB Octanoyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JGB6 9.26e-114 327 74 0 208 3 lipB Octanoyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q7N766 4.66e-113 324 71 0 207 3 lipB Octanoyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JPR8 5.92e-108 312 71 0 205 3 lipB Octanoyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GB10 1.52e-104 303 67 0 205 3 lipB Octanoyltransferase Serratia proteamaculans (strain 568)
C6DBV7 1.69e-103 300 70 0 202 3 lipB Octanoyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B2VBK0 1.5e-102 298 69 0 205 3 lipB Octanoyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6D7M7 2.55e-102 298 69 0 202 3 lipB Octanoyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6T691 8.17e-99 288 70 0 193 3 lipB Octanoyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XZS4 2.58e-98 287 70 0 193 3 lipB Octanoyltransferase Klebsiella pneumoniae (strain 342)
A4W816 1.62e-96 282 70 0 193 3 lipB Octanoyltransferase Enterobacter sp. (strain 638)
B7N9N6 1.12e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NLY9 1.12e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q3Z4G2 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Shigella sonnei (strain Ss046)
Q32IV0 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
Q324R3 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Shigella boydii serotype 4 (strain Sb227)
B2TU88 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RET2 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli (strain UTI89 / UPEC)
B6I139 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli (strain SE11)
P60720 1.46e-95 280 67 0 195 1 lipB Octanoyltransferase Escherichia coli (strain K12)
B1IYH8 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P60722 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TK43 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A8Q5 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli O1:K1 / APEC
A7ZXQ7 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli O9:H4 (strain HS)
C4ZWB7 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M5F7 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli O8 (strain IAI1)
B7MRR7 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli O81 (strain ED1a)
B5YQI1 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P60721 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli O157:H7
B7MFQ3 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UKS0 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZJ18 1.46e-95 280 67 0 195 3 lipB Octanoyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7L9H4 2.72e-95 279 67 0 195 3 lipB Octanoyltransferase Escherichia coli (strain 55989 / EAEC)
Q7UDD0 3.24e-95 279 67 0 195 3 lipB Octanoyltransferase Shigella flexneri
Q0T6P0 3.24e-95 279 67 0 195 3 lipB Octanoyltransferase Shigella flexneri serotype 5b (strain 8401)
B1LKM1 3.95e-95 279 67 0 195 3 lipB Octanoyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
Q6LN88 4e-95 279 64 0 203 3 lipB Octanoyltransferase Photobacterium profundum (strain SS9)
A8AJH4 2.99e-94 276 68 0 193 3 lipB Octanoyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q2SA37 3.51e-93 274 61 0 209 3 lipB Octanoyltransferase Hahella chejuensis (strain KCTC 2396)
A5UBB1 1.8e-91 270 61 2 210 3 lipB Octanoyltransferase Haemophilus influenzae (strain PittEE)
Q4QPL7 1.8e-91 270 61 2 210 3 lipB Octanoyltransferase Haemophilus influenzae (strain 86-028NP)
B0KJX5 2.06e-91 270 62 0 198 3 lipB Octanoyltransferase Pseudomonas putida (strain GB-1)
A5UFJ9 2.22e-91 269 61 2 210 3 lipB Octanoyltransferase Haemophilus influenzae (strain PittGG)
Q8Z8I2 3.02e-91 269 64 0 193 3 lipB Octanoyltransferase Salmonella typhi
B1J143 3.6e-91 269 62 0 198 3 lipB Octanoyltransferase Pseudomonas putida (strain W619)
Q8ZR03 4.33e-91 268 64 0 193 3 lipB Octanoyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PM99 4.33e-91 268 64 0 193 3 lipB Octanoyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A5F2Y1 5.01e-91 268 62 1 203 3 lipB Octanoyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KTF8 6.88e-91 268 62 1 203 3 lipB Octanoyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q87RR0 1.02e-90 268 62 0 201 3 lipB Octanoyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1I4G0 1.34e-90 267 62 0 198 3 lipB Octanoyltransferase Pseudomonas entomophila (strain L48)
Q7MN16 1.58e-90 267 61 0 203 3 lipB Octanoyltransferase Vibrio vulnificus (strain YJ016)
Q88DM4 1.78e-90 267 60 0 205 3 lipB Octanoyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P44464 2.09e-90 267 61 2 210 3 lipB Octanoyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8DFD2 2.68e-90 267 61 0 203 3 lipB Octanoyltransferase Vibrio vulnificus (strain CMCP6)
A5W9I6 5.68e-90 266 62 0 198 3 lipB Octanoyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q15VL2 2.28e-89 265 58 1 206 3 lipB Octanoyltransferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B7VKE7 3.1e-89 264 61 0 202 3 lipB Octanoyltransferase Vibrio atlanticus (strain LGP32)
Q0I1H7 4.5e-89 264 60 2 212 3 lipB Octanoyltransferase Histophilus somni (strain 129Pt)
B3PKN9 5.06e-89 263 62 1 197 3 lipB Octanoyltransferase Cellvibrio japonicus (strain Ueda107)
B0UVP8 5.13e-89 263 60 2 212 3 lipB Octanoyltransferase Histophilus somni (strain 2336)
A4SJV7 6.28e-89 263 58 1 206 3 lipB Octanoyltransferase Aeromonas salmonicida (strain A449)
A0KNA1 3.67e-88 262 57 1 210 3 lipB Octanoyltransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q7VKB0 3.9e-88 261 58 2 209 3 lipB Octanoyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A1U3B4 6.98e-88 260 61 0 199 3 lipB Octanoyltransferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q5E6V8 9.56e-88 261 57 1 211 3 lipB Octanoyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A7MY97 1.23e-87 260 68 0 175 3 lipB Octanoyltransferase Vibrio campbellii (strain ATCC BAA-1116)
Q65RH6 1.94e-87 259 60 2 207 3 lipB Octanoyltransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0BRS0 2.48e-87 259 58 2 209 3 lipB Octanoyltransferase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H2J1 2.75e-87 259 58 2 209 3 lipB Octanoyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N2P2 2.75e-87 259 58 2 209 3 lipB Octanoyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A4VQZ7 5.42e-87 258 58 0 205 3 lipB Octanoyltransferase Stutzerimonas stutzeri (strain A1501)
Q5QYE6 6.26e-87 258 57 0 203 3 lipB Octanoyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
C1DMR0 6.38e-87 258 60 1 202 3 lipB Octanoyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q2NUV7 1.37e-86 257 63 0 199 3 lipB Octanoyltransferase Sodalis glossinidius (strain morsitans)
A6VZ75 1.87e-85 254 60 0 204 3 lipB Octanoyltransferase Marinomonas sp. (strain MWYL1)
P57977 2.66e-85 254 59 2 207 3 lipB Octanoyltransferase Pasteurella multocida (strain Pm70)
Q3IJ80 9.66e-85 253 63 0 182 3 lipB Octanoyltransferase Pseudoalteromonas translucida (strain TAC 125)
A6VM78 2.1e-84 252 58 3 214 3 lipB Octanoyltransferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q3K6A3 1.41e-82 247 57 0 202 3 lipB Octanoyltransferase Pseudomonas fluorescens (strain Pf0-1)
Q87VW6 1.86e-82 247 57 0 202 3 lipB Octanoyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A9L013 1.92e-82 247 56 0 206 3 lipB Octanoyltransferase Shewanella baltica (strain OS195)
A6WRL1 1.92e-82 247 56 0 206 3 lipB Octanoyltransferase Shewanella baltica (strain OS185)
A3D7P8 1.92e-82 247 56 0 206 3 lipB Octanoyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E4W5 2.09e-82 247 56 0 206 3 lipB Octanoyltransferase Shewanella baltica (strain OS223)
Q4ZN83 2.21e-82 247 57 0 201 3 lipB Octanoyltransferase Pseudomonas syringae pv. syringae (strain B728a)
C3K2L9 2.66e-82 246 57 0 203 3 lipB Octanoyltransferase Pseudomonas fluorescens (strain SBW25)
Q4K5G9 2.94e-82 246 57 0 202 3 lipB Octanoyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A1RGT3 3.31e-82 246 57 0 206 3 lipB Octanoyltransferase Shewanella sp. (strain W3-18-1)
Q484R7 8.8e-82 246 63 0 179 3 lipB Octanoyltransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q57RU1 1.1e-81 244 66 0 171 3 lipB Octanoyltransferase Salmonella choleraesuis (strain SC-B67)
A4Y9G1 1.48e-81 244 56 0 206 3 lipB Octanoyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q9X6V9 1.58e-81 244 58 0 198 3 lipB Octanoyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02SG4 1.58e-81 244 58 0 198 3 lipB Octanoyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V8B6 1.58e-81 244 58 0 198 3 lipB Octanoyltransferase Pseudomonas aeruginosa (strain LESB58)
A6V0B3 1.58e-81 244 58 0 198 3 lipB Octanoyltransferase Pseudomonas aeruginosa (strain PA7)
Q48DM5 2.45e-81 244 58 0 198 3 lipB Octanoyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A0KTV5 2.65e-81 244 55 0 206 3 lipB Octanoyltransferase Shewanella sp. (strain ANA-3)
Q0HXV6 2.7e-81 244 55 0 206 3 lipB Octanoyltransferase Shewanella sp. (strain MR-7)
Q0HLK2 2.7e-81 244 55 0 206 3 lipB Octanoyltransferase Shewanella sp. (strain MR-4)
Q8EHQ5 6.34e-81 243 55 0 206 3 lipB Octanoyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q087L4 2.41e-80 241 54 0 206 3 lipB Octanoyltransferase Shewanella frigidimarina (strain NCIMB 400)
Q1QXA4 2.63e-80 241 58 2 205 3 lipB Octanoyltransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A3QH59 6.58e-80 240 54 0 206 3 lipB Octanoyltransferase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1S8U0 6.87e-80 240 56 0 206 3 lipB Octanoyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B1KDX2 1.03e-79 240 54 0 206 3 lipB Octanoyltransferase Shewanella woodyi (strain ATCC 51908 / MS32)
Q21FD9 1.51e-79 239 62 0 176 3 lipB Octanoyltransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A8FZ22 2.07e-79 239 55 0 206 3 lipB Octanoyltransferase Shewanella sediminis (strain HAW-EB3)
A4XYX4 3.57e-79 238 63 0 179 3 lipB Octanoyltransferase Pseudomonas mendocina (strain ymp)
A8H7D4 4.22e-79 238 54 0 205 3 lipB Octanoyltransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TR56 5.08e-79 238 55 0 205 3 lipB Octanoyltransferase Shewanella halifaxensis (strain HAW-EB4)
Q12QX0 1.5e-78 237 55 0 202 3 lipB Octanoyltransferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B8CSH6 4.14e-78 236 54 0 202 3 lipB Octanoyltransferase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q5GVR6 6.06e-78 236 56 0 200 3 lipB Octanoyltransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NYZ1 6.06e-78 236 56 0 200 3 lipB Octanoyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BXQ4 1.18e-77 235 56 0 200 3 lipB Octanoyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B0RNP8 1.48e-77 235 55 0 200 3 lipB Octanoyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q1LTM4 2.3e-77 234 57 3 205 3 lipB Octanoyltransferase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q8P589 2.48e-77 234 55 0 200 3 lipB Octanoyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UYT3 2.48e-77 234 55 0 200 3 lipB Octanoyltransferase Xanthomonas campestris pv. campestris (strain 8004)
Q8PPL9 3.44e-77 234 56 0 200 3 lipB Octanoyltransferase Xanthomonas axonopodis pv. citri (strain 306)
Q9JZA4 4.04e-75 228 58 1 193 3 lipB Octanoyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9LZ96 4.04e-75 228 58 1 193 3 lipB Octanoyltransferase Neisseria meningitidis serogroup C (strain 053442)
B4RLL0 5.36e-75 228 58 1 193 3 lipB Octanoyltransferase Neisseria gonorrhoeae (strain NCCP11945)
Q5F8I1 5.36e-75 228 58 1 193 3 lipB Octanoyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1KU21 8.39e-75 227 58 1 193 3 lipB Octanoyltransferase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A1SZ16 1.65e-74 227 54 2 200 3 lipB Octanoyltransferase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q9JUC7 1.74e-74 226 58 1 193 3 lipB Octanoyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q87DZ8 5.52e-73 223 55 0 201 3 lipB Octanoyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q83C64 1.61e-72 223 52 1 207 3 lipB Octanoyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NDX7 2.39e-72 222 52 1 207 3 lipB Octanoyltransferase Coxiella burnetii (strain RSA 331 / Henzerling II)
B6IZL5 2.39e-72 222 52 1 207 3 lipB Octanoyltransferase Coxiella burnetii (strain CbuG_Q212)
A9KFW4 3.65e-72 222 52 1 207 3 lipB Octanoyltransferase Coxiella burnetii (strain Dugway 5J108-111)
Q9PDV9 5.06e-72 221 54 0 201 3 lipB Octanoyltransferase Xylella fastidiosa (strain 9a5c)
A0Q6D2 5.46e-72 220 50 1 201 3 lipB Octanoyltransferase Francisella tularensis subsp. novicida (strain U112)
B6J7S2 7.1e-72 221 52 1 207 3 lipB Octanoyltransferase Coxiella burnetii (strain CbuK_Q154)
A4IXX8 1.38e-71 219 50 1 201 3 lipB Octanoyltransferase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BLW1 1.38e-71 219 50 1 201 3 lipB Octanoyltransferase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3E7 1.38e-71 219 50 1 201 3 lipB Octanoyltransferase Francisella tularensis subsp. holarctica (strain LVS)
A7NC90 1.38e-71 219 50 1 201 3 lipB Octanoyltransferase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B2SGJ2 4.74e-71 218 50 1 201 3 lipB Octanoyltransferase Francisella tularensis subsp. mediasiatica (strain FSC147)
Q5NG26 4.95e-71 218 50 1 201 3 lipB Octanoyltransferase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14HH8 4.95e-71 218 50 1 201 3 lipB Octanoyltransferase Francisella tularensis subsp. tularensis (strain FSC 198)
Q5X551 5.66e-71 217 50 0 198 3 lipB Octanoyltransferase Legionella pneumophila (strain Paris)
Q5ZVC9 9.25e-71 216 50 0 198 3 lipB Octanoyltransferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IC06 1.28e-70 216 50 0 198 3 lipB Octanoyltransferase Legionella pneumophila (strain Corby)
Q7NTG0 1.43e-70 216 51 0 197 3 lipB Octanoyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P57356 1.56e-70 216 46 0 203 3 lipB Octanoyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q47JD4 2.39e-70 216 57 0 176 3 lipB Octanoyltransferase Dechloromonas aromatica (strain RCB)
Q5WWD9 2.73e-70 215 50 0 198 3 lipB Octanoyltransferase Legionella pneumophila (strain Lens)
Q3J7W3 8.66e-70 215 50 0 202 3 lipB Octanoyltransferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q3SM28 1.57e-69 214 50 0 201 3 lipB Octanoyltransferase Thiobacillus denitrificans (strain ATCC 25259)
Q31F43 6.87e-69 212 51 1 199 3 lipB Octanoyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q60CJ7 2.63e-68 211 49 2 206 3 lipB Octanoyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q6F8H3 8.31e-68 210 49 1 206 3 lipB Octanoyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q0ACA3 2.71e-67 208 53 0 177 3 lipB Octanoyltransferase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
C1D5T4 8.75e-67 207 50 0 197 3 lipB Octanoyltransferase Laribacter hongkongensis (strain HLHK9)
Q0AI04 1.91e-66 206 48 1 204 3 lipB Octanoyltransferase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1AWI7 2.55e-66 206 52 0 172 3 lipB Octanoyltransferase Ruthia magnifica subsp. Calyptogena magnifica
Q5P4B9 5.95e-66 206 53 0 178 3 lipB Octanoyltransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q82UJ6 1.34e-65 204 47 1 204 3 lipB Octanoyltransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1WVS9 1.36e-65 204 53 1 182 3 lipB Octanoyltransferase Halorhodospira halophila (strain DSM 244 / SL1)
Q89AL8 8.67e-65 201 49 1 195 3 lipB Octanoyltransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8K9Q3 1.06e-64 202 41 1 214 3 lipB Octanoyltransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q2Y7I8 1.44e-63 199 53 1 172 3 lipB Octanoyltransferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q1GYC2 2.5e-62 196 46 0 203 3 lipB Octanoyltransferase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q2T1K6 1.39e-61 195 50 2 183 3 lipB Octanoyltransferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q0VN37 2.55e-61 194 54 0 164 3 lipB Octanoyltransferase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q63XX6 2.08e-60 191 49 2 183 3 lipB Octanoyltransferase Burkholderia pseudomallei (strain K96243)
Q62N15 2.08e-60 191 49 2 183 3 lipB Octanoyltransferase Burkholderia mallei (strain ATCC 23344)
A3NQX5 3.78e-60 191 49 2 183 3 lipB Octanoyltransferase Burkholderia pseudomallei (strain 1106a)
Q3JWL3 4.09e-60 191 49 2 183 3 lipB Octanoyltransferase Burkholderia pseudomallei (strain 1710b)
A1V017 4.14e-60 191 49 2 183 3 lipB Octanoyltransferase Burkholderia mallei (strain SAVP1)
A2S5Y8 4.14e-60 191 49 2 183 3 lipB Octanoyltransferase Burkholderia mallei (strain NCTC 10229)
A3MR18 4.14e-60 191 49 2 183 3 lipB Octanoyltransferase Burkholderia mallei (strain NCTC 10247)
A3N575 4.53e-60 191 49 2 183 3 lipB Octanoyltransferase Burkholderia pseudomallei (strain 668)
A4G9C5 6.69e-60 189 45 3 207 3 lipB Octanoyltransferase Herminiimonas arsenicoxydans
A6T344 7.88e-60 189 46 3 208 3 lipB Octanoyltransferase Janthinobacterium sp. (strain Marseille)
A5EY93 1.42e-59 188 47 1 196 3 lipB Octanoyltransferase Dichelobacter nodosus (strain VCS1703A)
Q146F2 2.72e-58 186 52 3 192 3 lipB Octanoyltransferase Paraburkholderia xenovorans (strain LB400)
A5CWR5 3.88e-58 185 50 0 172 3 lipB Octanoyltransferase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B2SWY4 4.63e-58 186 52 2 187 3 lipB Octanoyltransferase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B1JZ91 9.72e-58 185 47 3 212 3 lipB Octanoyltransferase Burkholderia orbicola (strain MC0-3)
Q39CJ1 1.06e-57 185 47 3 212 3 lipB Octanoyltransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q2L1E2 1.18e-57 184 48 1 193 3 lipB Octanoyltransferase Bordetella avium (strain 197N)
Q0BBH9 1.29e-57 185 47 2 210 3 lipB Octanoyltransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YNM7 1.64e-57 184 47 2 210 3 lipB Octanoyltransferase Burkholderia ambifaria (strain MC40-6)
A9AEG7 2.39e-57 184 49 3 208 3 lipB Octanoyltransferase Burkholderia multivorans (strain ATCC 17616 / 249)
A9IH67 2.4e-57 183 53 3 172 3 lipB Octanoyltransferase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q1BT81 3.4e-57 184 47 3 212 3 lipB Octanoyltransferase Burkholderia orbicola (strain AU 1054)
A0KAV9 4.13e-57 184 47 3 212 3 lipB Octanoyltransferase Burkholderia cenocepacia (strain HI2424)
A1K1U6 1.11e-56 182 49 1 187 3 lipB Octanoyltransferase Azoarcus sp. (strain BH72)
A4JI72 3.82e-56 181 47 3 212 3 lipB Octanoyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q7WR01 6.07e-56 179 47 2 195 3 lipB Octanoyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q477G6 9.56e-56 180 53 2 175 3 lipB Octanoyltransferase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q7W223 9.68e-56 179 47 2 195 3 lipB Octanoyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q8D326 1.59e-55 178 40 3 202 3 lipB Octanoyltransferase Wigglesworthia glossinidia brevipalpis
B1XSA5 2.47e-55 178 47 2 184 3 lipB Octanoyltransferase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
B2JC45 2.75e-55 179 47 2 209 3 lipB Octanoyltransferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q7W0K9 3.17e-55 178 46 2 195 3 lipB Octanoyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A1VIU0 3.25e-54 175 43 1 198 3 lipB Octanoyltransferase Polaromonas naphthalenivorans (strain CJ2)
Q21RG9 1.2e-53 174 41 1 224 3 lipB Octanoyltransferase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q0KFE7 1.4e-53 175 53 2 174 3 lipB Octanoyltransferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q12GR3 1.92e-53 174 38 1 245 3 lipB Octanoyltransferase Polaromonas sp. (strain JS666 / ATCC BAA-500)
B2UE02 2.01e-53 174 48 1 179 3 lipB Octanoyltransferase Ralstonia pickettii (strain 12J)
Q8Y2L2 2.34e-53 173 48 1 179 3 lipB Octanoyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A2SCI8 4.13e-53 172 46 1 194 3 lipB Octanoyltransferase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A4T0B0 2.38e-52 170 45 2 186 3 lipB Octanoyltransferase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
C5CP20 3.8e-52 170 42 3 220 3 lipB Octanoyltransferase Variovorax paradoxus (strain S110)
A1WF49 4.86e-52 170 38 1 225 3 lipB Octanoyltransferase Verminephrobacter eiseniae (strain EF01-2)
A9BPT8 7.97e-51 167 39 1 230 3 lipB Octanoyltransferase Delftia acidovorans (strain DSM 14801 / SPH-1)
A1TJ32 1.31e-49 164 37 1 228 3 lipB Octanoyltransferase Paracidovorax citrulli (strain AAC00-1)
Q4FS63 5.37e-46 156 39 4 222 3 lipB Octanoyltransferase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1QBT8 6.22e-45 154 37 4 231 3 lipB Octanoyltransferase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q1MG80 1.44e-41 144 39 3 202 3 lipB Octanoyltransferase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q11JI3 2.25e-41 143 37 2 207 3 lipB Octanoyltransferase Chelativorans sp. (strain BNC1)
A7HWU9 7.71e-41 141 38 2 199 3 lipB Octanoyltransferase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q2K833 8.16e-41 142 38 4 222 3 lipB Octanoyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A6U899 2.2e-40 141 39 2 198 3 lipB Octanoyltransferase Sinorhizobium medicae (strain WSM419)
Q92QD5 3.53e-40 140 38 2 203 3 lipB Octanoyltransferase Rhizobium meliloti (strain 1021)
B3PP01 4.99e-40 139 39 3 207 3 lipB Octanoyltransferase Rhizobium etli (strain CIAT 652)
A1UT80 7.85e-39 136 35 2 207 3 lipB Octanoyltransferase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A3PH28 9.51e-39 135 38 3 202 3 lipB Octanoyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q577Y8 1.33e-38 137 38 2 197 3 lipB Octanoyltransferase Brucella abortus biovar 1 (strain 9-941)
Q2YKK8 1.33e-38 137 38 2 197 3 lipB Octanoyltransferase Brucella abortus (strain 2308)
Q8UF44 2.51e-38 136 36 2 207 3 lipB Octanoyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q3J5A6 4.3e-38 134 38 3 202 3 lipB Octanoyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
C0RLB0 4.92e-38 135 38 1 180 3 lipB Octanoyltransferase Brucella melitensis biotype 2 (strain ATCC 23457)
Q8YC54 5.13e-38 135 38 1 180 3 lipB Octanoyltransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FW72 1.53e-37 134 38 1 180 3 lipB Octanoyltransferase Brucella suis biovar 1 (strain 1330)
Q98KT0 1.69e-37 133 38 1 183 3 lipB Octanoyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A4WQA7 3.19e-37 132 35 2 206 3 lipB Octanoyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A4YT30 5.89e-37 132 40 3 177 3 lipB Octanoyltransferase Bradyrhizobium sp. (strain ORS 278)
Q9A6B8 6.42e-37 131 40 2 179 3 lipB Octanoyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A5V649 1.11e-36 130 38 2 193 3 lipB Octanoyltransferase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A9IVX0 2.4e-36 130 33 2 196 3 lipB Octanoyltransferase Bartonella tribocorum (strain CIP 105476 / IBS 506)
A5EL70 2.41e-36 130 40 3 182 3 lipB Octanoyltransferase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q5HAP4 2.5e-36 129 36 3 191 3 lipB Octanoyltransferase Ehrlichia ruminantium (strain Welgevonden)
Q5FFZ7 2.5e-36 129 36 3 191 3 lipB Octanoyltransferase Ehrlichia ruminantium (strain Gardel)
Q1QLD9 2.99e-36 130 38 3 184 3 lipB Octanoyltransferase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q135D0 3.7e-36 130 37 4 207 3 lipB Octanoyltransferase Rhodopseudomonas palustris (strain BisB5)
Q6FZQ9 4.33e-36 129 33 2 196 3 lipB Octanoyltransferase Bartonella quintana (strain Toulouse)
Q5LTM4 1.16e-35 127 37 1 180 3 lipB Octanoyltransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q0ANV0 1.63e-35 127 37 4 201 3 lipB Octanoyltransferase Maricaulis maris (strain MCS10)
Q211P6 1.69e-35 128 41 3 177 3 lipB Octanoyltransferase Rhodopseudomonas palustris (strain BisB18)
Q28SZ3 5.97e-35 126 36 1 185 3 lipB Octanoyltransferase Jannaschia sp. (strain CCS1)
Q3SRU9 6.67e-35 126 36 3 178 3 lipB Octanoyltransferase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q6G3I3 6.96e-35 126 32 2 196 3 lipB Octanoyltransferase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q4FLP4 7.93e-35 125 29 4 188 3 lipB Octanoyltransferase Pelagibacter ubique (strain HTCC1062)
C0QQ61 9.67e-35 125 35 3 186 3 lipB Octanoyltransferase Persephonella marina (strain DSM 14350 / EX-H1)
Q5NMY4 1.41e-34 125 32 2 193 3 lipB Octanoyltransferase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q7ND22 1.57e-34 125 34 3 203 3 lipB Octanoyltransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q2GH92 1.7e-34 124 35 3 184 3 lipB Octanoyltransferase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q07L16 3.49e-34 124 37 3 177 3 lipB Octanoyltransferase Rhodopseudomonas palustris (strain BisA53)
Q89JM6 4.31e-34 124 36 4 201 3 lipB Octanoyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q2RSU9 5.65e-34 123 38 1 175 3 lipB Octanoyltransferase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q6KZK7 8e-34 124 39 3 166 3 lipB2 Probable octanoyltransferase 2 Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
A8LRT6 8.11e-34 123 36 4 210 3 lipB Octanoyltransferase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q2IXI4 9.46e-34 124 37 3 182 3 lipB Octanoyltransferase Rhodopseudomonas palustris (strain HaA2)
Q2W9F0 1.15e-33 122 36 2 189 3 lipB Octanoyltransferase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q3YRI1 1.32e-33 122 35 2 167 3 lipB Octanoyltransferase Ehrlichia canis (strain Jake)
Q2GL91 7.56e-33 120 33 3 196 3 lipB Octanoyltransferase Anaplasma phagocytophilum (strain HZ)
A1B3D5 8.34e-33 120 36 2 179 3 lipB Octanoyltransferase Paracoccus denitrificans (strain Pd 1222)
B3QAV6 1.22e-32 120 37 3 182 3 lipB Octanoyltransferase Rhodopseudomonas palustris (strain TIE-1)
Q6N514 1.26e-32 120 37 3 182 3 lipB Octanoyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q7U8F2 1.5e-32 120 34 2 182 3 lipB Octanoyltransferase Parasynechococcus marenigrum (strain WH8102)
A5G0V3 4.19e-32 119 35 3 201 3 lipB Octanoyltransferase Acidiphilium cryptum (strain JF-5)
A9HJ12 6.95e-32 118 34 5 220 3 lipB Octanoyltransferase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q73GE2 1.02e-31 117 31 4 195 3 lipB Octanoyltransferase Wolbachia pipientis wMel
Q2JKB7 3.45e-31 117 38 0 144 3 lipB Octanoyltransferase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q5PA33 6.73e-31 115 37 2 167 3 lipB Octanoyltransferase Anaplasma marginale (strain St. Maries)
B9KJ95 6.73e-31 115 37 2 167 3 lipB Octanoyltransferase Anaplasma marginale (strain Florida)
B6JF54 8.02e-31 116 37 3 177 3 lipB Octanoyltransferase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q5SLQ3 9.68e-31 115 33 6 212 1 lipB Octanoyltransferase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72GV2 9.68e-31 115 33 6 212 3 lipB Octanoyltransferase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A0L510 1.87e-30 114 36 2 183 3 lipB Octanoyltransferase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q02AK4 2.3e-30 114 35 3 207 3 lipB Octanoyltransferase Solibacter usitatus (strain Ellin6076)
A4WK37 7.27e-30 112 37 3 170 3 lipB Probable octanoyltransferase Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321 / PZ6)
Q8DKM7 7.76e-30 113 31 3 204 3 lipB Octanoyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q39S09 1.18e-29 112 32 3 196 3 lipB Octanoyltransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q3AI29 1.45e-29 112 30 2 171 3 lipB Octanoyltransferase Synechococcus sp. (strain CC9605)
C4K2Y1 1.5e-29 112 31 4 195 3 lipB Octanoyltransferase Rickettsia peacockii (strain Rustic)
Q4UJQ5 1.54e-29 112 31 4 198 3 lipB Octanoyltransferase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q6ARJ9 1.73e-29 112 38 3 158 3 lipB Octanoyltransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q92FX0 1.99e-29 111 33 3 172 3 lipB Octanoyltransferase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q0C3A9 2.16e-29 112 34 2 173 3 lipB Octanoyltransferase Hyphomonas neptunium (strain ATCC 15444)
A8GQA5 3.18e-29 111 30 4 198 3 lipB Octanoyltransferase Rickettsia akari (strain Hartford)
A8GU54 3.43e-29 110 33 3 172 3 lipB Octanoyltransferase Rickettsia rickettsii (strain Sheila Smith)
B0BVP3 3.43e-29 110 33 3 172 3 lipB Octanoyltransferase Rickettsia rickettsii (strain Iowa)
Q3AZ50 4.41e-29 111 33 3 177 3 lipB Octanoyltransferase Synechococcus sp. (strain CC9902)
B2IVM2 4.66e-29 111 29 2 211 3 lipB Octanoyltransferase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
C3PM18 5.31e-29 110 33 3 172 3 lipB Octanoyltransferase Rickettsia africae (strain ESF-5)
Q2GC80 6.02e-29 110 35 3 180 3 lipB Octanoyltransferase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A8F300 7.06e-29 110 33 3 172 3 lipB Octanoyltransferase Rickettsia massiliae (strain Mtu5)
A8F0A0 8.5e-29 110 33 3 172 3 lipB Octanoyltransferase Rickettsia canadensis (strain McKiel)
Q10ZL5 8.54e-29 110 30 2 213 3 lipB Octanoyltransferase Trichodesmium erythraeum (strain IMS101)
Q5GT50 9.13e-29 109 30 4 187 3 lipB Octanoyltransferase Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q9ZC91 1.36e-28 109 30 4 198 3 lipB Octanoyltransferase Rickettsia prowazekii (strain Madrid E)
Q9X6X4 2.02e-28 112 34 4 211 3 lipB Octanoyltransferase Myxococcus xanthus
B0K3J8 2.08e-28 109 29 3 206 3 lipB Octanoyltransferase Thermoanaerobacter sp. (strain X514)
A9BE20 2.09e-28 109 31 2 177 3 lipB Octanoyltransferase Prochlorococcus marinus (strain MIT 9211)
B3CLJ0 2.15e-28 108 29 4 185 3 lipB Octanoyltransferase Wolbachia pipientis subsp. Culex pipiens (strain wPip)
A6TWD0 2.24e-28 109 34 3 182 3 lipB Octanoyltransferase Alkaliphilus metalliredigens (strain QYMF)
Q8ZUR4 2.25e-28 109 34 2 172 3 lipB Probable octanoyltransferase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
B0K8D0 3.33e-28 108 29 3 205 3 lipB Octanoyltransferase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B8DZW2 4.97e-28 108 34 4 176 3 lipB Octanoyltransferase Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
A5US49 5.2e-28 108 32 5 208 3 lipB Octanoyltransferase Roseiflexus sp. (strain RS-1)
A5GAC4 5.25e-28 108 33 3 192 3 lipB Octanoyltransferase Geotalea uraniireducens (strain Rf4)
B8G783 6.01e-28 108 33 6 207 3 lipB Octanoyltransferase Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q68VN7 6.47e-28 107 31 3 172 3 lipB Octanoyltransferase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q7V2R8 7.46e-28 107 27 3 214 3 lipB Octanoyltransferase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q2NDR7 9.16e-28 107 33 4 180 3 lipB Octanoyltransferase Erythrobacter litoralis (strain HTCC2594)
Q8A8S8 9.23e-28 107 37 3 155 3 lipB Octanoyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q8R9E0 9.75e-28 107 31 3 197 3 lipB Octanoyltransferase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A3PBB9 1.14e-27 107 26 3 216 3 lipB Octanoyltransferase Prochlorococcus marinus (strain MIT 9301)
B5YD73 1.31e-27 107 31 5 201 3 lipB Octanoyltransferase Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Q30XT7 1.49e-27 107 32 2 197 3 lipB Octanoyltransferase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A0LIW0 2.86e-27 106 32 4 208 3 lipB Octanoyltransferase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A5GJ90 3.14e-27 107 30 2 186 3 lipB Octanoyltransferase Synechococcus sp. (strain WH7803)
A2BV61 3.43e-27 105 27 3 214 3 lipB Octanoyltransferase Prochlorococcus marinus (strain MIT 9515)
Q1RKI1 4.37e-27 105 32 3 178 3 lipB Octanoyltransferase Rickettsia bellii (strain RML369-C)
A8GUN4 4.37e-27 105 32 3 178 3 lipB Octanoyltransferase Rickettsia bellii (strain OSU 85-389)
Q5FUX5 4.64e-27 106 35 6 195 3 lipB Octanoyltransferase Gluconobacter oxydans (strain 621H)
Q8YSA4 6.74e-27 105 29 3 210 3 lipB Octanoyltransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q1AT14 7.74e-27 105 34 6 209 3 lipB Octanoyltransferase Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q2JTV2 1.38e-26 105 33 1 149 3 lipB Octanoyltransferase Synechococcus sp. (strain JA-3-3Ab)
Q3M698 2.41e-26 103 29 3 211 3 lipB Octanoyltransferase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q64UP8 2.66e-26 103 33 4 199 3 lipB Octanoyltransferase Bacteroides fragilis (strain YCH46)
Q5LDM3 2.71e-26 103 33 4 199 3 lipB Octanoyltransferase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A1VF78 3.41e-26 103 35 3 176 3 lipB Octanoyltransferase Nitratidesulfovibrio vulgaris (strain DP4)
Q72DM3 3.41e-26 103 35 3 176 3 lipB Octanoyltransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q7V8V9 3.99e-26 103 29 1 171 3 lipB Octanoyltransferase Prochlorococcus marinus (strain MIT 9313)
Q1B6R2 4.19e-26 103 31 5 209 3 lipB Octanoyltransferase Mycobacterium sp. (strain MCS)
A1UIB3 4.19e-26 103 31 5 209 3 lipB Octanoyltransferase Mycobacterium sp. (strain KMS)
A3Q1S7 4.19e-26 103 31 5 209 3 lipB Octanoyltransferase Mycobacterium sp. (strain JLS)
B3CRE6 4.35e-26 102 34 4 172 3 lipB Octanoyltransferase Orientia tsutsugamushi (strain Ikeda)
A8G3B3 5.03e-26 103 26 3 216 3 lipB Octanoyltransferase Prochlorococcus marinus (strain MIT 9215)
A1AMT7 7.27e-26 102 32 3 176 3 lipB Octanoyltransferase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
P74519 7.35e-26 102 29 3 204 3 lipB Octanoyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B9LM66 8.76e-26 102 33 6 207 3 lipB Octanoyltransferase Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WKF8 8.76e-26 102 33 6 207 3 lipB Octanoyltransferase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
B8DRR1 1.52e-25 101 31 2 197 3 lipB Octanoyltransferase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q3A7N4 1.55e-25 101 31 3 192 3 lipB Octanoyltransferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
O32961 1.86e-25 102 30 3 185 3 lipB Octanoyltransferase Mycobacterium leprae (strain TN)
B8ZQK0 1.86e-25 102 30 3 185 3 lipB Octanoyltransferase Mycobacterium leprae (strain Br4923)
A6GYW1 1.98e-25 102 32 3 200 3 lipB Octanoyltransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
A5CEL3 2.06e-25 101 33 3 171 3 lipB Octanoyltransferase Orientia tsutsugamushi (strain Boryong)
A2C0K7 2.21e-25 102 31 3 178 3 lipB Octanoyltransferase Prochlorococcus marinus (strain NATL1A)
Q8FNP5 2.23e-25 102 33 5 187 3 lipB Octanoyltransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q1GTF8 2.94e-25 100 35 3 169 3 lipB Octanoyltransferase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q46H10 4.34e-25 101 30 3 178 3 lipB Octanoyltransferase Prochlorococcus marinus (strain NATL2A)
A0M5H7 5.53e-25 100 29 5 222 3 lipB Octanoyltransferase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q00520 7.62e-25 98 35 1 146 3 lipB Octanoyltransferase (Fragment) Paracoccus versutus
B5EDZ5 1.03e-24 99 37 1 135 3 lipB Octanoyltransferase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
P0C7R2 1.09e-24 100 30 3 200 1 LIP2P2 Octanoyltransferase LIP2p2, chloroplastic Arabidopsis thaliana
A2BPM9 1.11e-24 99 25 3 216 3 lipB Octanoyltransferase Prochlorococcus marinus (strain AS9601)
A3MW04 1.46e-24 99 31 3 178 3 lipB Probable octanoyltransferase Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
Q7VDH8 1.92e-24 99 28 2 190 3 lipB Octanoyltransferase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q6NG87 1.96e-24 99 34 5 187 3 lipB Octanoyltransferase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A6L9E1 2.34e-24 99 31 2 157 3 lipB Octanoyltransferase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q29R99 2.96e-24 98 35 4 174 2 lipt2 Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial Danio rerio
B8J3G1 3.59e-24 98 36 2 166 3 lipB Octanoyltransferase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q948J9 5.25e-24 99 35 2 145 1 LIP2P Octanoyltransferase LIP2p, chloroplastic Arabidopsis thaliana
P9WK83 5.42e-24 98 32 4 181 1 lipB Octanoyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WK82 5.42e-24 98 32 4 181 3 lipB Octanoyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U4P5 5.42e-24 98 32 4 181 3 lipB Octanoyltransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C6E0V3 7.39e-24 97 36 1 135 3 lipB Octanoyltransferase Geobacter sp. (strain M21)
C1AQD2 9.99e-24 97 32 4 181 3 lipB Octanoyltransferase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KKQ9 9.99e-24 97 32 4 181 3 lipB Octanoyltransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7VEN4 9.99e-24 97 32 4 181 3 lipB Octanoyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0QEY7 1.36e-23 97 30 5 206 3 lipB Octanoyltransferase Mycobacterium avium (strain 104)
Q6L1M2 2.36e-23 95 35 6 162 3 lipB1 Probable octanoyltransferase 1 Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q31CD7 2.38e-23 95 30 4 188 3 lipB Octanoyltransferase Prochlorococcus marinus (strain MIT 9312)
A5FIL6 3.02e-23 96 30 3 200 3 lipB Octanoyltransferase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q73YJ7 3.05e-23 96 29 5 206 3 lipB Octanoyltransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0JVC9 3.18e-23 95 31 5 189 3 lipB Octanoyltransferase Arthrobacter sp. (strain FB24)
A4TBJ9 3.25e-23 96 32 3 178 3 lipB Octanoyltransferase Mycolicibacterium gilvum (strain PYR-GCK)
Q5YZ58 4.93e-23 95 29 6 211 3 lipB Octanoyltransferase Nocardia farcinica (strain IFM 10152)
Q8NNJ1 6.26e-23 95 31 5 183 3 lipB Octanoyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QFS2 6.26e-23 95 31 5 183 3 lipB Octanoyltransferase Corynebacterium glutamicum (strain R)
Q7MUY1 9.4e-23 98 32 2 157 3 lipB Octanoyltransferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
A5MZJ0 1.07e-22 94 30 1 168 3 lipB Octanoyltransferase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Q0VFH3 1.21e-22 94 30 4 221 2 lipt2 Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial Xenopus tropicalis
Q6A9W7 1.21e-22 95 36 3 151 3 lipB Octanoyltransferase Cutibacterium acnes (strain DSM 16379 / KPA171202)
A1R5J6 1.5e-22 94 30 5 189 3 lipB Octanoyltransferase Paenarthrobacter aurescens (strain TC1)
Q1IIJ5 1.82e-22 94 33 4 176 3 lipB Octanoyltransferase Koribacter versatilis (strain Ellin345)
Q11XW2 2.75e-22 94 30 4 203 3 lipB Octanoyltransferase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A0LTE0 3.14e-22 93 32 7 198 3 lipB Octanoyltransferase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
C1F3S1 4.17e-22 93 30 5 223 3 lipB Octanoyltransferase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
B8HGZ8 4.79e-22 92 31 5 189 3 lipB Octanoyltransferase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A0R074 5.03e-22 92 30 5 208 3 lipB Octanoyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q74AE2 5.11e-22 92 35 1 141 3 lipB Octanoyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q2GEU6 5.24e-22 92 29 3 166 3 lipB Octanoyltransferase Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
A4XHV1 5.56e-22 92 29 6 214 3 lipB Octanoyltransferase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B9MQ23 5.89e-22 92 30 4 184 3 lipB Octanoyltransferase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q8F5F1 6.99e-22 92 32 3 154 3 lipB Octanoyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72QP1 7.07e-22 92 32 3 155 3 lipB Octanoyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
O36017 9.39e-22 92 38 1 131 3 SPAC4F10.05c Probable octanoyltransferase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q5N180 1.51e-21 91 27 3 212 3 lipB Octanoyltransferase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31KN6 1.51e-21 91 27 3 212 3 lipB Octanoyltransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
C6BZY6 1.56e-21 91 28 5 202 3 lipB Octanoyltransferase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A1TB25 2.64e-21 91 31 4 179 3 lipB Octanoyltransferase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q9RWA5 2.9e-21 92 36 7 187 3 lipB Octanoyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q47R87 3.1e-21 90 32 4 175 3 lipB Octanoyltransferase Thermobifida fusca (strain YX)
A9WS39 3.68e-21 90 35 4 151 3 lipB Octanoyltransferase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
A4XA20 4.46e-21 90 31 6 189 3 lipB Octanoyltransferase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A8LYF4 6.58e-21 89 32 5 173 3 lipB Octanoyltransferase Salinispora arenicola (strain CNS-205)
A4J246 6e-20 87 35 1 117 3 lipB Octanoyltransferase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q6AFG6 8.71e-20 86 29 4 188 3 lipB Octanoyltransferase Leifsonia xyli subsp. xyli (strain CTCB07)
A5CQA0 1.25e-19 86 30 4 178 3 lipB Octanoyltransferase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
A0PNH8 1.82e-19 86 29 6 213 3 lipB Octanoyltransferase Mycobacterium ulcerans (strain Agy99)
Q9VN27 1.89e-19 86 33 1 154 2 Lipt2 Putative lipoyltransferase 2, mitochondrial Drosophila melanogaster
Q052G1 2.95e-19 85 32 3 152 3 lipB Octanoyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04TD5 2.95e-19 85 32 3 152 3 lipB Octanoyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B2HHL3 3.96e-19 85 28 6 215 3 lipB Octanoyltransferase Mycobacterium marinum (strain ATCC BAA-535 / M)
B0RE23 5.22e-19 85 31 5 179 3 lipB Octanoyltransferase Clavibacter sepedonicus
Q4JWD9 1.08e-18 84 29 5 188 3 lipB Octanoyltransferase Corynebacterium jeikeium (strain K411)
Q2JB35 1.53e-18 83 35 4 153 3 lipB Octanoyltransferase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q9SXP7 2.04e-18 83 30 3 160 1 LIP2 Octanoyltransferase LIP2, mitochondrial Arabidopsis thaliana
Q6MPS6 3.22e-18 82 28 5 192 3 lipB Octanoyltransferase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q83I07 5.57e-18 82 28 5 191 3 lipB Octanoyltransferase Tropheryma whipplei (strain TW08/27)
Q2RZI1 5.91e-18 82 31 5 176 3 lipB Octanoyltransferase Salinibacter ruber (strain DSM 13855 / M31)
Q83G63 6.94e-18 82 28 5 191 3 lipB Octanoyltransferase Tropheryma whipplei (strain Twist)
C1AUB9 1.03e-17 82 29 4 186 3 lipB Octanoyltransferase Rhodococcus opacus (strain B4)
C3PHK5 1.47e-17 81 34 4 150 3 lipB Octanoyltransferase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q06005 9.08e-17 80 34 5 141 1 LIP2 Octanoyltransferase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B2GJ87 1.57e-16 78 31 4 153 3 lipB Octanoyltransferase Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Q0SHK6 1.68e-16 78 28 4 186 3 lipB Octanoyltransferase Rhodococcus jostii (strain RHA1)
O13476 1.18e-15 77 30 5 153 3 LIPB Octanoyltransferase, mitochondrial Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q8CK04 1.24e-14 73 27 5 209 3 lipB Octanoyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q82AP6 6.47e-14 71 26 4 208 3 lipB Octanoyltransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B1VZM4 1.8e-13 70 27 4 201 3 lipB Octanoyltransferase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q9D009 8.48e-13 68 32 3 149 1 Lipt2 Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial Mus musculus
O19898 1.25e-12 67 27 1 133 3 lipB Probable octanoyltransferase Cyanidium caldarium
A6NK58 1.54e-12 67 35 3 134 1 LIPT2 Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial Homo sapiens
Q51854 8.64e-05 43 24 2 111 3 lipB Octanoyltransferase (Fragment) Prochlorothrix hollandica

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_10105
Feature type CDS
Gene lipB
Product lipoyl(octanoyl) transferase LipB
Location 113322 - 113954 (strand: 1)
Length 633 (nucleotides) / 210 (amino acids)

Contig

Accession contig_11
Length 143616 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1560
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF21948 Lipoyl protein ligase A/B catalytic domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0321 Coenzyme transport and metabolism (H) H Lipoate-protein ligase B

Kegg Ortholog Annotation(s)

Protein Sequence

MQNNTIILRQLGLRPYHPVSEAMHQFTEQRTAETGNEIWLVEHERVFTQGQAGKAEHVISPGDIPVIQSDRGGQVTYHGPGQQVMYVMIDLKRDKIGVRELVTALENSVVETLKQWNIDAYPRPDAPGVYVAGNKICSLGLRIRNGRSFHGLALNINMDLEPFHRINPCGYAGLAMTQMADFVPGITLADVQPVLTAQFCRQLGFQLAAE

Flanking regions ( +/- flanking 50bp)

GCCGTGCGCGTTATACTGCTGGCCCGGCATACCGAACTGAAGATACCATTTTGCAAAATAACACCATTATTTTACGTCAGCTGGGCCTGCGGCCTTATCATCCTGTCTCTGAAGCCATGCACCAATTTACCGAACAGCGTACGGCGGAAACCGGTAACGAGATCTGGCTGGTCGAGCATGAGCGCGTTTTTACCCAGGGCCAGGCAGGGAAAGCCGAACATGTTATCTCCCCCGGTGATATCCCGGTGATCCAGTCTGATCGCGGCGGCCAGGTGACCTACCACGGCCCGGGACAGCAGGTCATGTATGTGATGATTGATCTCAAACGCGACAAAATCGGTGTGCGCGAACTGGTAACCGCGCTGGAAAATTCAGTGGTTGAGACCCTGAAACAGTGGAATATTGACGCTTACCCGCGCCCGGATGCGCCCGGTGTTTATGTGGCGGGTAACAAAATCTGTTCACTCGGTCTGCGGATCCGCAACGGCCGCTCATTCCACGGCCTGGCGCTCAATATCAATATGGATCTCGAGCCTTTTCACCGTATTAATCCGTGTGGCTATGCCGGTCTCGCCATGACACAAATGGCTGATTTTGTTCCCGGTATTACCCTTGCGGATGTTCAGCCCGTGCTGACCGCACAATTCTGCCGGCAATTAGGATTCCAACTTGCCGCAGAATAGTGATATAATTTTTTTAACATTTTTAAAAAGATTTTTAAAAGATTGATGAC