Homologs in group_1562

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_04590 EHELCC_04590 100.0 Morganella morganii S2 cydX cytochrome bd-I oxidase subunit CydX
NLDBIP_04590 NLDBIP_04590 100.0 Morganella morganii S4 cydX cytochrome bd-I oxidase subunit CydX
LHKJJB_14040 LHKJJB_14040 100.0 Morganella morganii S3 cydX cytochrome bd-I oxidase subunit CydX
HKOGLL_12495 HKOGLL_12495 100.0 Morganella morganii S5 cydX cytochrome bd-I oxidase subunit CydX
F4V73_RS00555 F4V73_RS00555 94.3 Morganella psychrotolerans cydX cytochrome bd-I oxidase subunit CydX
PMI_RS18845 PMI_RS18845 71.4 Proteus mirabilis HI4320 cydX cytochrome bd-I oxidase subunit CydX

Distribution of the homologs in the orthogroup group_1562

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1562

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P56100 1.71e-10 51 71 0 35 1 cydX Cytochrome bd-I ubiquinol oxidase subunit X Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_09790
Feature type CDS
Gene cydX
Product cytochrome bd-I oxidase subunit CydX
Location 51630 - 51737 (strand: -1)
Length 108 (nucleotides) / 35 (amino acids)
In genomic island -

Contig

Accession contig_11
Length 143616 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1562
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF08173 Membrane bound YbgT-like protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4890 Function unknown (S) S Predicted outer membrane lipoprotein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00424 cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Oxidative phosphorylation
Metabolic pathways
Two-component system
Cytochrome bd ubiquinol oxidase

Protein Sequence

MWYFAWILGTLLACSIAVIAALAIEHHEDKAASGE

Flanking regions ( +/- flanking 50bp)

GTCCTTCATCGAAGAGAACAAACATACATTGTACTAAGGAGCAGACGAATATGTGGTATTTTGCATGGATCCTCGGAACGCTCCTGGCCTGTAGTATTGCTGTTATTGCAGCACTGGCTATTGAGCACCACGAAGATAAAGCCGCTTCAGGCGAGTAAGACGGATGCTGGATAAGTCTTACCAACTACTGGATAAGGGTCCCTTACGG