Homologs in group_14

Help

18 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09000 FBDBKF_09000 56.8 Morganella morganii S1 xerD Site-specific recombinase XerD
FBDBKF_09050 FBDBKF_09050 51.4 Morganella morganii S1 xerD Site-specific recombinase XerD
EHELCC_10360 EHELCC_10360 51.4 Morganella morganii S2 xerD Site-specific recombinase XerD
EHELCC_10410 EHELCC_10410 56.8 Morganella morganii S2 xerD Site-specific recombinase XerD
EHELCC_10455 EHELCC_10455 100.0 Morganella morganii S2 xerD Site-specific recombinase XerD
NLDBIP_10705 NLDBIP_10705 51.4 Morganella morganii S4 xerD Site-specific recombinase XerD
NLDBIP_10755 NLDBIP_10755 56.8 Morganella morganii S4 xerD Site-specific recombinase XerD
NLDBIP_10800 NLDBIP_10800 100.0 Morganella morganii S4 xerD Site-specific recombinase XerD
LHKJJB_10555 LHKJJB_10555 100.0 Morganella morganii S3 xerD Site-specific recombinase XerD
LHKJJB_10600 LHKJJB_10600 56.8 Morganella morganii S3 xerD Site-specific recombinase XerD
LHKJJB_10650 LHKJJB_10650 51.4 Morganella morganii S3 xerD Site-specific recombinase XerD
HKOGLL_13615 HKOGLL_13615 100.0 Morganella morganii S5 xerD Site-specific recombinase XerD
HKOGLL_13660 HKOGLL_13660 56.8 Morganella morganii S5 xerD Site-specific recombinase XerD
HKOGLL_13710 HKOGLL_13710 51.4 Morganella morganii S5 xerD Site-specific recombinase XerD
F4V73_RS10920 F4V73_RS10920 49.7 Morganella psychrotolerans - tyrosine-type DNA invertase
F4V73_RS10970 F4V73_RS10970 57.4 Morganella psychrotolerans - tyrosine-type DNA invertase
F4V73_RS11015 F4V73_RS11015 86.3 Morganella psychrotolerans - tyrosine-type recombinase/integrase
PMI_RS01270 PMI_RS01270 49.2 Proteus mirabilis HI4320 mrpI phase variation DNA invertase MrpI

Distribution of the homologs in the orthogroup group_14

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_14

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADH5 1.1e-61 192 52 0 180 3 fimB Type 1 fimbriae regulatory protein FimB Escherichia coli (strain K12)
P0ADH6 1.1e-61 192 52 0 180 3 fimB Type 1 fimbriae regulatory protein FimB Escherichia coli O157:H7
P0ADH9 1.53e-57 182 50 1 179 3 fimE Type 1 fimbriae regulatory protein FimE Shigella flexneri
P0ADH7 1.53e-57 182 50 1 179 3 fimE Type 1 fimbriae regulatory protein FimE Escherichia coli (strain K12)
P0ADH8 1.53e-57 182 50 1 179 3 fimE Type 1 fimbriae regulatory protein FimE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q49890 1.3e-20 89 30 3 188 3 xerD Tyrosine recombinase XerD Mycobacterium leprae (strain TN)
Q7ZAP1 3.17e-20 88 33 3 155 3 xerD Tyrosine recombinase XerD Bifidobacterium longum (strain NCC 2705)
Q8TZV9 2.07e-19 86 30 5 170 3 xerA Tyrosine recombinase XerA Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O26979 1.23e-18 84 31 4 185 3 xerA Tyrosine recombinase XerA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q7NVH1 1.81e-18 84 34 2 146 3 xerC Tyrosine recombinase XerC Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7ZAN4 5.9e-18 82 31 4 183 3 xerD Tyrosine recombinase XerD Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q2NB52 1.18e-17 81 32 5 178 3 xerC Tyrosine recombinase XerC Erythrobacter litoralis (strain HTCC2594)
P9WF33 3.08e-17 80 29 3 185 1 xerD Tyrosine recombinase XerD Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WF32 3.08e-17 80 29 3 185 3 xerD Tyrosine recombinase XerD Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67637 3.08e-17 80 29 3 185 3 xerD Tyrosine recombinase XerD Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8XWD0 7.15e-17 79 28 2 180 3 xerD Tyrosine recombinase XerD Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9KA25 9.2e-17 79 30 4 183 3 xerC Tyrosine recombinase XerC Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8X574 1.21e-16 79 29 6 188 3 xerD Tyrosine recombinase XerD Escherichia coli O157:H7
Q7ZAM0 1.59e-16 78 29 6 188 3 xerD Tyrosine recombinase XerD Shigella flexneri
P0A8P8 1.65e-16 78 29 6 188 1 xerD Tyrosine recombinase XerD Escherichia coli (strain K12)
P0A8P9 1.65e-16 78 29 6 188 3 xerD Tyrosine recombinase XerD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A2P6 1.74e-16 78 29 6 188 1 xerD Tyrosine recombinase XerD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2P7 1.74e-16 78 29 6 188 3 xerD Tyrosine recombinase XerD Salmonella typhi
Q7ZAJ2 2.26e-16 78 30 4 185 3 xerD Tyrosine recombinase XerD Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HP53 2.28e-16 78 30 4 185 3 xerD Tyrosine recombinase XerD Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O84351 2.71e-16 78 32 3 167 3 xerC Tyrosine recombinase XerC Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B0BBY1 2.71e-16 78 32 3 167 3 xerC Tyrosine recombinase XerC Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Q3KM11 2.71e-16 78 32 3 167 3 xerC Tyrosine recombinase XerC Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0B7R6 2.71e-16 78 32 3 167 3 xerC Tyrosine recombinase XerC Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
O59490 3.54e-16 77 28 5 178 3 xerA Tyrosine recombinase XerA Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
O31206 3.94e-16 77 30 6 188 1 xerD Tyrosine recombinase XerD Proteus mirabilis
B3GZ58 5.47e-16 77 29 2 167 3 xerC Tyrosine recombinase XerC Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q9V1P5 5.83e-16 77 31 4 170 1 xerA Tyrosine recombinase XerA Pyrococcus abyssi (strain GE5 / Orsay)
Q2LT92 5.97e-16 77 29 3 181 3 xerC Tyrosine recombinase XerC Syntrophus aciditrophicus (strain SB)
Q9A437 6.76e-16 77 33 5 174 3 xerD Tyrosine recombinase XerD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P0A0P1 8.28e-16 76 30 4 179 3 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain MW2)
P0A0P2 8.28e-16 76 30 4 179 3 xerD Tyrosine recombinase XerD Staphylococcus aureus
Q6G967 8.28e-16 76 30 4 179 3 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain MSSA476)
Q6GGK1 8.28e-16 76 30 4 179 3 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain MRSA252)
P0A0P0 8.28e-16 76 30 4 179 1 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain N315)
P0A0N9 8.28e-16 76 30 4 179 3 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFS5 8.28e-16 76 30 4 179 3 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain COL)
Q8NQL5 1.06e-15 76 30 4 173 3 xerD Tyrosine recombinase XerD Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A8FD78 1.48e-15 75 30 3 153 3 xerC Tyrosine recombinase XerC Bacillus pumilus (strain SAFR-032)
Q7ZAK0 2.14e-15 75 33 5 148 3 xerC Tyrosine recombinase XerC Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B7VMD2 2.3e-15 75 29 1 167 3 xerC Tyrosine recombinase XerC Vibrio atlanticus (strain LGP32)
Q7ZAM7 3.17e-15 75 27 3 169 3 xerD Tyrosine recombinase XerD Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72SA5 3.17e-15 75 27 3 169 3 xerD Tyrosine recombinase XerD Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q7ZAM3 3.37e-15 75 29 2 178 3 xerD Tyrosine recombinase XerD Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9HXQ6 4.7e-15 74 30 3 180 3 xerD Tyrosine recombinase XerD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A1AKP9 6.22e-15 74 29 6 181 3 xerC Tyrosine recombinase XerC Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q8VS06 6.23e-15 74 31 4 165 3 xerC Tyrosine recombinase XerC Pseudomonas fluorescens
Q49XU5 7.34e-15 73 28 4 185 3 xerD Tyrosine recombinase XerD Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A4TEB1 7.54e-15 73 29 4 162 3 xerC Tyrosine recombinase XerC Mycolicibacterium gilvum (strain PYR-GCK)
Q98FX8 8.12e-15 73 33 5 156 3 xerD Tyrosine recombinase XerD Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q02E82 8.48e-15 73 31 3 164 3 xerC Tyrosine recombinase XerC Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V5H1 8.48e-15 73 31 3 164 3 xerC Tyrosine recombinase XerC Pseudomonas aeruginosa (strain LESB58)
Q8ZHK1 9.23e-15 73 28 6 188 3 xerD Tyrosine recombinase XerD Yersinia pestis
A3PXY1 9.89e-15 73 29 2 158 3 xerC Tyrosine recombinase XerC Mycobacterium sp. (strain JLS)
Q8NNZ9 1.03e-14 73 28 5 171 3 xerC Tyrosine recombinase XerC Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q1BAI5 1.04e-14 73 29 2 158 3 xerC Tyrosine recombinase XerC Mycobacterium sp. (strain MCS)
A1UEH7 1.04e-14 73 29 2 158 3 xerC Tyrosine recombinase XerC Mycobacterium sp. (strain KMS)
P44818 1.12e-14 73 28 2 170 1 xerC Tyrosine recombinase XerC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UE41 1.18e-14 73 29 3 177 3 xerC Tyrosine recombinase XerC Haemophilus influenzae (strain PittEE)
Q51566 1.18e-14 73 31 3 164 3 xerC Tyrosine recombinase XerC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q87DN0 1.21e-14 73 32 5 180 3 xerD Tyrosine recombinase XerD Xylella fastidiosa (strain Temecula1 / ATCC 700964)
A6VE54 1.46e-14 73 31 3 164 3 xerC Tyrosine recombinase XerC Pseudomonas aeruginosa (strain PA7)
Q7MQB9 1.6e-14 73 26 1 167 3 xerC Tyrosine recombinase XerC Vibrio vulnificus (strain YJ016)
Q7ZAI9 1.6e-14 73 26 1 167 3 xerC Tyrosine recombinase XerC Vibrio vulnificus (strain CMCP6)
Q88B11 1.72e-14 73 34 4 146 3 xerC Tyrosine recombinase XerC Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A6VQS4 1.82e-14 72 27 3 170 3 xerC Tyrosine recombinase XerC Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B6YWN8 1.94e-14 72 27 3 176 3 xerA Tyrosine recombinase XerA Thermococcus onnurineus (strain NA1)
Q9PK47 1.94e-14 73 31 2 152 3 xerC Tyrosine recombinase XerC Chlamydia muridarum (strain MoPn / Nigg)
Q4QMP0 2.11e-14 72 28 2 170 3 xerC Tyrosine recombinase XerC Haemophilus influenzae (strain 86-028NP)
B0UWL5 2.22e-14 72 28 2 167 3 xerC Tyrosine recombinase XerC Histophilus somni (strain 2336)
C1DJ58 2.26e-14 72 31 3 157 3 xerC Tyrosine recombinase XerC Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q3K4R6 2.7e-14 72 30 4 165 3 xerC Tyrosine recombinase XerC Pseudomonas fluorescens (strain Pf0-1)
A0QVB4 3.04e-14 72 27 2 158 3 xerC Tyrosine recombinase XerC Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A1SAP3 3.66e-14 72 28 3 164 3 xerC Tyrosine recombinase XerC Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q88MV0 3.77e-14 72 30 7 185 3 xerD Tyrosine recombinase XerD Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q5JHA3 4.3e-14 71 27 4 179 3 xerA Tyrosine recombinase XerA Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q9CPF0 4.38e-14 72 27 5 178 3 xerD Tyrosine recombinase XerD Pasteurella multocida (strain Pm70)
Q500B4 6.02e-14 71 34 4 146 3 xerC Tyrosine recombinase XerC Pseudomonas syringae pv. syringae (strain B728a)
Q9PDF4 6.37e-14 71 30 4 178 3 xerD Tyrosine recombinase XerD Xylella fastidiosa (strain 9a5c)
Q7ZAJ5 7.04e-14 71 29 2 147 3 xerC Tyrosine recombinase XerC Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q87KJ6 7.56e-14 71 26 1 167 3 xerC Tyrosine recombinase XerC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q48C04 7.97e-14 71 34 4 146 3 xerC Tyrosine recombinase XerC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A9B1E0 9.5e-14 70 31 7 173 3 xerC Tyrosine recombinase XerC Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
B7IFN3 9.92e-14 70 25 4 178 3 THA_404 Tyrosine recombinase THA_404 Thermosipho africanus (strain TCF52B)
A7N0V8 1.03e-13 70 25 1 167 3 xerC Tyrosine recombinase XerC Vibrio campbellii (strain ATCC BAA-1116)
A1SQX0 1.1e-13 70 30 2 149 3 xerC Tyrosine recombinase XerC Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q4L6J7 1.16e-13 70 28 4 184 3 xerD Tyrosine recombinase XerD Staphylococcus haemolyticus (strain JCSC1435)
Q8Z3A8 1.17e-13 70 29 2 146 3 xerC Tyrosine recombinase XerC Salmonella typhi
Q1QSU9 1.19e-13 70 30 4 150 3 xerC Tyrosine recombinase XerC Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
P55888 1.34e-13 70 29 2 146 3 xerC Tyrosine recombinase XerC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q92A53 1.37e-13 70 27 2 159 3 xerD Tyrosine recombinase XerD Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q89XW5 1.51e-13 70 31 6 192 3 xerD Tyrosine recombinase XerD Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q04A03 1.52e-13 70 30 5 170 3 xerC Tyrosine recombinase XerC Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G9V2 1.52e-13 70 30 5 170 3 xerC Tyrosine recombinase XerC Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q65JN5 1.68e-13 70 30 6 176 3 xerC Tyrosine recombinase XerC Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q0HN93 2.06e-13 70 28 3 163 3 xerC Tyrosine recombinase XerC Shewanella sp. (strain MR-4)
A0KS67 2.06e-13 70 28 3 163 3 xerC Tyrosine recombinase XerC Shewanella sp. (strain ANA-3)
Q0HQJ4 2.08e-13 70 28 3 163 3 xerC Tyrosine recombinase XerC Shewanella sp. (strain MR-7)
Q9KPE9 2.47e-13 69 27 6 185 3 xerD Tyrosine recombinase XerD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q48733 2.48e-13 69 30 5 170 3 xerC Tyrosine recombinase XerC Lactobacillus leichmannii
Q7VKG8 2.48e-13 69 29 2 167 3 xerC Tyrosine recombinase XerC Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B5YFZ8 4.24e-13 69 28 3 173 3 xerC Tyrosine recombinase XerC Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A1RPD0 4.36e-13 69 30 2 147 3 xerC Tyrosine recombinase XerC Shewanella sp. (strain W3-18-1)
A4YBF5 4.36e-13 69 30 2 147 3 xerC Tyrosine recombinase XerC Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B7UNC8 4.91e-13 68 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8Y5V0 5.02e-13 68 27 2 159 3 xerD Tyrosine recombinase XerD Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q1I301 5.1e-13 68 29 3 164 3 xerC Tyrosine recombinase XerC Pseudomonas entomophila (strain L48)
C3LPX0 5.23e-13 68 27 2 168 3 xerC Tyrosine recombinase XerC Vibrio cholerae serotype O1 (strain M66-2)
Q9KVL4 5.23e-13 68 27 2 168 3 xerC Tyrosine recombinase XerC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4I4 5.23e-13 68 27 2 168 3 xerC Tyrosine recombinase XerC Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q71Y59 5.49e-13 68 27 3 181 3 xerD Tyrosine recombinase XerD Listeria monocytogenes serotype 4b (strain F2365)
Q4K3W0 6.36e-13 68 30 3 164 3 xerC Tyrosine recombinase XerC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B3E1H7 6.62e-13 68 31 4 147 3 xerC Tyrosine recombinase XerC Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q8KET0 7.56e-13 68 27 4 161 3 xerD Tyrosine recombinase XerD Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q9JV76 9.81e-13 68 31 6 169 3 xerD Tyrosine recombinase XerD Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q8PPP9 1.25e-12 67 29 3 168 3 xerC Tyrosine recombinase XerC Xanthomonas axonopodis pv. citri (strain 306)
A5URM3 1.25e-12 67 28 3 153 3 xerC Tyrosine recombinase XerC Roseiflexus sp. (strain RS-1)
B3DQV1 1.39e-12 68 29 6 161 3 xerC Tyrosine recombinase XerC Bifidobacterium longum (strain DJO10A)
B5YY58 1.77e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4T6 1.77e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli O157:H7
B7GQE1 1.79e-12 67 29 6 161 3 xerC Tyrosine recombinase XerC Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q253S9 1.87e-12 67 31 6 172 3 xerC Tyrosine recombinase XerC Chlamydia felis (strain Fe/C-56)
Q0SZ02 1.93e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Shigella flexneri serotype 5b (strain 8401)
B7M613 1.97e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli O8 (strain IAI1)
A7ZU16 1.97e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3YVF5 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Shigella sonnei (strain Ss046)
Q7ZAL9 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Shigella flexneri
Q329Y7 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Shigella dysenteriae serotype 1 (strain Sd197)
Q31UH7 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Shigella boydii serotype 4 (strain Sb227)
B2TUW7 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LU45 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LLY2 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli (strain SMS-3-5 / SECEC)
B6I4F2 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli (strain SE11)
B7NFB3 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8P6 1.99e-12 67 28 2 146 1 xerC Tyrosine recombinase XerC Escherichia coli (strain K12)
B1IW93 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8P7 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAR4 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A6R9 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli O9:H4 (strain HS)
B1XAH7 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli (strain K12 / DH10B)
C4ZZ74 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli (strain K12 / MC4100 / BW2952)
B7N2A1 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli O81 (strain ED1a)
B7NTD1 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7L968 1.99e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli (strain 55989 / EAEC)
Q1R4C3 2.01e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli (strain UTI89 / UPEC)
A1AHX9 2.01e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli O1:K1 / APEC
B7MH75 2.01e-12 67 28 2 146 3 xerC Tyrosine recombinase XerC Escherichia coli O45:K1 (strain S88 / ExPEC)
B1J1V8 2.28e-12 67 29 3 157 3 xerC Tyrosine recombinase XerC Pseudomonas putida (strain W619)
Q9KCP0 2.31e-12 67 25 4 181 3 xerD Tyrosine recombinase XerD Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B4RNW5 2.5e-12 67 31 3 147 3 xerC Tyrosine recombinase XerC Neisseria gonorrhoeae (strain NCCP11945)
Q5FAI3 2.5e-12 67 31 3 147 3 xerC Tyrosine recombinase XerC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A4VGW3 2.84e-12 67 29 4 165 3 xerC Tyrosine recombinase XerC Stutzerimonas stutzeri (strain A1501)
Q7MNQ0 3.49e-12 66 24 4 181 3 xerD Tyrosine recombinase XerD Vibrio vulnificus (strain YJ016)
Q7ZAJ0 3.49e-12 66 24 4 181 3 xerD Tyrosine recombinase XerD Vibrio vulnificus (strain CMCP6)
Q7ZAM5 4.22e-12 66 29 2 149 3 xerC Tyrosine recombinase XerC Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9CBU0 4.29e-12 66 27 2 158 3 xerC Tyrosine recombinase XerC Mycobacterium leprae (strain TN)
A1KS31 4.34e-12 66 31 3 147 3 xerC Tyrosine recombinase XerC Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q823T9 4.35e-12 66 30 6 172 3 xerC Tyrosine recombinase XerC Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
A9M1G2 4.39e-12 66 31 3 147 3 xerC Tyrosine recombinase XerC Neisseria meningitidis serogroup C (strain 053442)
Q9JW14 4.47e-12 66 31 3 147 3 xerC Tyrosine recombinase XerC Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P9WF35 4.63e-12 66 28 2 158 1 xerC Tyrosine recombinase XerC Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WF34 4.63e-12 66 28 2 158 3 xerC Tyrosine recombinase XerC Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U6P9 4.63e-12 66 28 2 158 3 xerC Tyrosine recombinase XerC Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AG09 4.63e-12 66 28 2 158 3 xerC Tyrosine recombinase XerC Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KMN8 4.63e-12 66 28 2 158 3 xerC Tyrosine recombinase XerC Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P67629 4.63e-12 66 28 2 158 3 xerC Tyrosine recombinase XerC Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q65V80 4.71e-12 66 26 2 167 3 xerC Tyrosine recombinase XerC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9K068 5.16e-12 65 29 5 175 3 xerD Tyrosine recombinase XerD Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
O31207 5.52e-12 66 27 3 168 1 xerC Tyrosine recombinase XerC Proteus mirabilis
C4ZGY6 6.68e-12 65 29 3 162 3 EUBREC_2677 Tyrosine recombinase EUBREC_2677 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q9PD96 7.03e-12 65 28 2 165 3 xerC Tyrosine recombinase XerC Xylella fastidiosa (strain 9a5c)
A8F7B4 7.26e-12 65 28 2 149 3 Tlet_1492 Tyrosine recombinase Tlet_1492 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q8U9U6 8.47e-12 65 29 5 167 3 xerD Tyrosine recombinase XerD Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0VM16 1.06e-11 65 29 3 148 3 xerC Tyrosine recombinase XerC Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q97HE5 1.15e-11 65 25 3 168 3 CA_C2066 Putative tyrosine recombinase CA_C2066 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
O31087 1.26e-11 65 28 2 146 3 xerC Tyrosine recombinase XerC Serratia marcescens
Q03FK2 1.27e-11 65 27 5 178 3 xerC Tyrosine recombinase XerC Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B2U7W2 1.35e-11 65 29 5 185 3 xerC Tyrosine recombinase XerC Ralstonia pickettii (strain 12J)
P39776 1.35e-11 65 30 5 153 1 xerC Tyrosine recombinase XerC Bacillus subtilis (strain 168)
Q1RHT1 1.36e-11 65 30 5 160 3 xerD Tyrosine recombinase XerD Rickettsia bellii (strain RML369-C)
Q9CKC2 1.58e-11 64 27 2 170 3 xerC Tyrosine recombinase XerC Pasteurella multocida (strain Pm70)
Q8P550 1.59e-11 64 28 2 165 3 xerC Tyrosine recombinase XerC Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RNK3 1.59e-11 64 28 2 165 3 xerC Tyrosine recombinase XerC Xanthomonas campestris pv. campestris (strain B100)
Q4UYY0 1.59e-11 64 28 2 165 3 xerC Tyrosine recombinase XerC Xanthomonas campestris pv. campestris (strain 8004)
A5WAU7 2.09e-11 64 27 3 164 3 xerC Tyrosine recombinase XerC Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q92ME3 2.15e-11 64 32 5 156 3 xerD Tyrosine recombinase XerD Rhizobium meliloti (strain 1021)
Q9JXV6 2.22e-11 64 30 3 147 3 xerC Tyrosine recombinase XerC Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q93C64 2.45e-11 64 27 6 173 3 xerD Tyrosine recombinase XerD Lacticaseibacillus casei
B0KQ43 2.49e-11 64 27 3 164 3 xerC Tyrosine recombinase XerC Pseudomonas putida (strain GB-1)
Q7VPN8 2.61e-11 63 26 6 188 3 xerD Tyrosine recombinase XerD Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B2A335 2.78e-11 63 30 4 190 3 xerC Tyrosine recombinase XerC Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q87DI2 2.97e-11 63 27 2 165 3 xerC Tyrosine recombinase XerC Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2IA18 2.97e-11 63 27 2 165 3 xerC Tyrosine recombinase XerC Xylella fastidiosa (strain M23)
Q98ED9 3.66e-11 63 29 2 157 3 xerC Tyrosine recombinase XerC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8D1K0 3.78e-11 63 27 5 171 3 xerC Tyrosine recombinase XerC Yersinia pestis
Q1D804 3.9e-11 63 28 5 174 3 xerC Tyrosine recombinase XerC Myxococcus xanthus (strain DK1622)
P59818 3.9e-11 63 28 5 174 3 xerC Tyrosine recombinase XerC Myxococcus xanthus
Q4UM01 4.07e-11 63 30 7 179 3 xerD Tyrosine recombinase XerD Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A7NFG3 4.46e-11 63 30 6 157 3 xerC Tyrosine recombinase XerC Roseiflexus castenholzii (strain DSM 13941 / HLO8)
P44630 5.1e-11 63 24 5 178 3 xerD Tyrosine recombinase XerD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8Y3C8 5.29e-11 63 28 4 185 3 xerC1 Tyrosine recombinase XerC 1 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q92IC9 5.57e-11 63 30 7 179 3 xerD Tyrosine recombinase XerD Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q7ZAJ8 6.83e-11 62 28 5 177 3 xerD Tyrosine recombinase XerD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A0AI80 7.68e-11 62 28 5 159 3 xerC Tyrosine recombinase XerC Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
C3K438 8.68e-11 62 28 2 157 3 xerC Tyrosine recombinase XerC Pseudomonas fluorescens (strain SBW25)
Q4L5V4 1.05e-10 62 23 2 176 3 xerC Tyrosine recombinase XerC Staphylococcus haemolyticus (strain JCSC1435)
B7GGC7 1.09e-10 62 28 2 149 3 xerC Tyrosine recombinase XerC Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q7ZAJ4 1.16e-10 62 25 5 188 3 xerC Tyrosine recombinase XerC Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPU0 1.16e-10 62 25 5 188 3 xerC Tyrosine recombinase XerC Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q5L6G3 1.4e-10 62 28 7 174 3 xerC Tyrosine recombinase XerC Chlamydia abortus (strain DSM 27085 / S26/3)
Q88CF1 1.44e-10 62 26 3 164 3 xerC Tyrosine recombinase XerC Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9Z9F7 1.45e-10 62 29 5 175 3 xerC Tyrosine recombinase XerC Chlamydia pneumoniae
Q9ZDG8 1.5e-10 62 30 5 158 3 xerD Tyrosine recombinase XerD Rickettsia prowazekii (strain Madrid E)
Q92C75 2.25e-10 61 28 5 159 3 xerC Tyrosine recombinase XerC Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8XTL6 2.69e-10 61 25 2 180 3 xerC2 Tyrosine recombinase XerC 2 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8Y7K0 4.51e-10 60 28 3 149 3 xerC Tyrosine recombinase XerC Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8RAB1 4.81e-10 60 26 2 136 3 TTE1313 Putative tyrosine recombinase TTE1313 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8UC70 4.82e-10 60 29 2 155 3 xerC Tyrosine recombinase XerC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q7ZAM8 5.32e-10 60 24 4 178 3 xerC Tyrosine recombinase XerC Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72RY9 5.32e-10 60 24 4 178 3 xerC Tyrosine recombinase XerC Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B8DG54 5.48e-10 60 27 5 159 3 xerC Tyrosine recombinase XerC Listeria monocytogenes serotype 4a (strain HCC23)
Q8PGR5 6.62e-10 60 27 4 177 3 xerD Tyrosine recombinase XerD Xanthomonas axonopodis pv. citri (strain 306)
Q8YJP2 8.83e-10 59 31 4 154 3 xerD Tyrosine recombinase XerD Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P0C122 8.92e-10 59 31 4 154 3 xerD Tyrosine recombinase XerD Brucella abortus biovar 1 (strain 9-941)
Q2YR40 8.92e-10 59 31 4 154 2 xerD Tyrosine recombinase XerD Brucella abortus (strain 2308)
Q7ZAN6 9.01e-10 59 31 4 154 3 xerD Tyrosine recombinase XerD Brucella suis biovar 1 (strain 1330)
Q49X37 9.28e-10 59 22 2 176 3 xerC Tyrosine recombinase XerC Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q720E4 1.01e-09 59 27 4 159 3 xerC Tyrosine recombinase XerC Listeria monocytogenes serotype 4b (strain F2365)
C1L2I5 1.01e-09 59 27 4 159 3 xerC Tyrosine recombinase XerC Listeria monocytogenes serotype 4b (strain CLIP80459)
P46352 2.18e-09 58 24 2 157 3 xerD Tyrosine recombinase XerD Bacillus subtilis (strain 168)
Q5LZT9 2.58e-09 58 31 4 153 3 xerS Tyrosine recombinase XerS Streptococcus thermophilus (strain CNRZ 1066)
Q5M4E9 2.97e-09 58 31 4 153 3 xerS Tyrosine recombinase XerS Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
B6IPE2 7.51e-09 57 30 2 146 3 xerC Tyrosine recombinase XerC Rhodospirillum centenum (strain ATCC 51521 / SW)
Q03KP9 7.81e-09 57 32 3 151 3 xerS Tyrosine recombinase XerS Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
O84872 8.38e-09 57 31 8 179 3 xerD Tyrosine recombinase XerD Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B9DUD2 9.1e-09 57 30 4 153 3 xerS Tyrosine recombinase XerS Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q9KJF6 1.03e-08 56 25 6 193 3 xerC Tyrosine recombinase XerC Staphylococcus aureus
Q039E1 1.04e-08 56 27 4 162 3 xerC Tyrosine recombinase XerC Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WEA7 1.04e-08 56 27 4 162 3 xerC Tyrosine recombinase XerC Lacticaseibacillus casei (strain BL23)
B4SDZ2 1.09e-08 57 24 3 165 3 xerC Tyrosine recombinase XerC Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q9Z6N5 1.16e-08 56 31 7 175 3 xerD Tyrosine recombinase XerD Chlamydia pneumoniae
A0LEB8 1.25e-08 56 30 3 153 3 xerC Tyrosine recombinase XerC Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
P67631 1.4e-08 56 25 6 193 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain N315)
P67630 1.4e-08 56 25 6 193 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X1M7 1.4e-08 56 25 6 193 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain Mu3 / ATCC 700698)
A5ISD6 1.44e-08 56 25 6 193 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain JH9)
A6U170 1.44e-08 56 25 6 193 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain JH1)
Q9PL53 1.61e-08 56 30 7 175 3 xerD Tyrosine recombinase XerD Chlamydia muridarum (strain MoPn / Nigg)
Q0PA27 1.86e-08 56 26 7 177 1 xerH Tyrosine recombinase XerH Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q980D9 2.3e-08 55 24 5 178 1 xerA Tyrosine recombinase XerA Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q7ZAN7 2.54e-08 55 31 3 155 3 xerC Tyrosine recombinase XerC Brucella suis biovar 1 (strain 1330)
A5D2W6 3.15e-08 55 28 4 185 3 xerC Tyrosine recombinase XerC Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B0UNY7 3.21e-08 55 30 4 158 3 xerC Tyrosine recombinase XerC Methylobacterium sp. (strain 4-46)
A8Z3T2 3.31e-08 55 25 6 193 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain USA300 / TCH1516)
A6QGF2 3.31e-08 55 25 6 193 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain Newman)
Q5HGI0 3.31e-08 55 25 6 193 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain COL)
Q2FZ30 3.31e-08 55 25 6 193 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHI6 3.31e-08 55 25 6 193 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain USA300)
P67633 3.36e-08 55 29 4 153 3 xerS Tyrosine recombinase XerS Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P67632 3.36e-08 55 29 4 153 3 xerS Tyrosine recombinase XerS Streptococcus agalactiae serotype III (strain NEM316)
Q3K1A9 3.36e-08 55 29 4 153 3 xerS Tyrosine recombinase XerS Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8PCQ9 6.03e-08 54 27 7 179 3 xerD Tyrosine recombinase XerD Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q6GHI3 6.24e-08 54 25 6 193 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain MRSA252)
Q8NWZ8 6.3e-08 54 25 6 193 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain MW2)
Q6G9W1 6.3e-08 54 25 6 193 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain MSSA476)
Q2YXL6 7.49e-08 54 23 5 192 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain bovine RF122 / ET3-1)
A8GXV3 8.43e-08 54 25 6 181 3 xerC Tyrosine recombinase XerC Rickettsia bellii (strain OSU 85-389)
Q1RK56 1.07e-07 53 25 6 181 3 xerC Tyrosine recombinase XerC Rickettsia bellii (strain RML369-C)
A8AXA5 1.5e-07 53 27 4 153 3 xerS Tyrosine recombinase XerS Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
P55429 1.53e-07 53 27 6 169 3 NGR_a03870 Putative integrase/recombinase y4eF Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B9DPG4 2.4e-07 52 21 2 176 3 xerC Tyrosine recombinase XerC Staphylococcus carnosus (strain TM300)
C1CRN6 2.41e-07 53 28 4 153 3 xerS Tyrosine recombinase XerS Streptococcus pneumoniae (strain Taiwan19F-14)
C1CEC5 2.41e-07 53 28 4 153 3 xerS Tyrosine recombinase XerS Streptococcus pneumoniae (strain JJA)
Q7ZAK7 2.41e-07 53 28 4 153 1 xerS Tyrosine recombinase XerS Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IPW6 2.41e-07 53 28 4 153 3 xerS Tyrosine recombinase XerS Streptococcus pneumoniae (strain CGSP14)
Q04KF1 2.41e-07 53 28 4 153 3 xerS Tyrosine recombinase XerS Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q89X68 2.44e-07 52 28 3 156 3 xerC Tyrosine recombinase XerC Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
C1CKQ9 2.46e-07 52 28 4 153 3 xerS Tyrosine recombinase XerS Streptococcus pneumoniae (strain P1031)
B8ZQ39 2.5e-07 52 28 4 153 3 xerS Tyrosine recombinase XerS Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1C7D0 2.5e-07 52 28 4 153 3 xerS Tyrosine recombinase XerS Streptococcus pneumoniae (strain 70585)
Q8P0Y8 2.62e-07 52 30 3 151 3 xerS Tyrosine recombinase XerS Streptococcus pyogenes serotype M18 (strain MGAS8232)
B5E4Q4 2.62e-07 52 28 4 153 3 xerS Tyrosine recombinase XerS Streptococcus pneumoniae serotype 19F (strain G54)
Q1JLL7 2.67e-07 52 30 3 151 3 xerS Tyrosine recombinase XerS Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q48TG2 2.7e-07 52 30 3 151 3 xerS Tyrosine recombinase XerS Streptococcus pyogenes serotype M28 (strain MGAS6180)
B5XLN3 2.78e-07 52 30 3 151 3 xerS Tyrosine recombinase XerS Streptococcus pyogenes serotype M49 (strain NZ131)
B8I9N8 2.8e-07 52 30 4 156 3 xerC Tyrosine recombinase XerC Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A3CN22 2.83e-07 52 27 4 153 3 xerS Tyrosine recombinase XerS Streptococcus sanguinis (strain SK36)
P0DH45 2.83e-07 52 30 3 151 3 xerS Tyrosine recombinase XerS Streptococcus pyogenes serotype M3 (strain SSI-1)
Q1J6H1 2.83e-07 52 30 3 151 3 xerS Tyrosine recombinase XerS Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JBN4 2.83e-07 52 30 3 151 3 xerS Tyrosine recombinase XerS Streptococcus pyogenes serotype M12 (strain MGAS2096)
P0DH44 2.83e-07 52 30 3 151 3 xerS Tyrosine recombinase XerS Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P67634 2.83e-07 52 30 3 151 3 xerS Tyrosine recombinase XerS Streptococcus pyogenes serotype M1
Q1JGQ2 2.89e-07 52 30 3 151 3 xerS Tyrosine recombinase XerS Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q8YJD9 4.11e-07 52 30 3 155 3 xerC Tyrosine recombinase XerC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
B1IBW3 4.18e-07 52 28 4 153 3 xerS Tyrosine recombinase XerS Streptococcus pneumoniae (strain Hungary19A-6)
Q92LK1 4.42e-07 52 26 2 155 3 xerC Tyrosine recombinase XerC Rhizobium meliloti (strain 1021)
O69155 4.46e-07 52 29 4 153 3 xerS Tyrosine recombinase XerS Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q73NE4 4.9e-07 52 28 5 160 3 xerC Tyrosine recombinase XerC Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q3SVJ8 5.09e-07 52 29 4 154 3 xerC Tyrosine recombinase XerC Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
P55632 5.7e-07 51 26 6 163 3 NGR_a01870 Putative integrase/recombinase y4qK Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P10020 6.19e-07 51 25 4 170 3 tnpI TnP I resolvase Bacillus thuringiensis
A8GQ15 7.18e-07 51 25 5 162 3 xerC Tyrosine recombinase XerC Rickettsia akari (strain Hartford)
A2RED8 7.38e-07 51 29 3 151 3 xerS Tyrosine recombinase XerS Streptococcus pyogenes serotype M5 (strain Manfredo)
Q5XC26 7.45e-07 51 29 3 151 3 xerS Tyrosine recombinase XerS Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
A4VUQ8 9.9e-07 51 31 4 153 3 xerS Tyrosine recombinase XerS Streptococcus suis (strain 05ZYH33)
A4W104 9.9e-07 51 31 4 153 3 xerS Tyrosine recombinase XerS Streptococcus suis (strain 98HAH33)
P72680 1.02e-06 51 29 4 155 3 xerC Tyrosine recombinase slr0733 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9ZCE0 1.47e-06 50 25 5 162 3 xerC Tyrosine recombinase XerC Rickettsia prowazekii (strain Madrid E)
O25386 1.59e-06 50 28 7 177 1 xerH Tyrosine recombinase XerH Helicobacter pylori (strain ATCC 700392 / 26695)
P55639 2.68e-06 50 26 4 165 3 NGR_a01810 Putative integrase/recombinase y4rF Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A8F033 2.96e-06 49 25 5 162 3 xerC Tyrosine recombinase XerC Rickettsia canadensis (strain McKiel)
Q8KBZ5 3.08e-06 49 24 3 162 3 xerC Tyrosine recombinase XerC Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q57813 4.25e-06 49 24 4 154 3 MJ0367 Probable integrase/recombinase protein MJ0367 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
B3QM22 4.54e-06 49 23 3 165 3 xerC Tyrosine recombinase XerC Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q97QP2 4.76e-06 49 28 4 153 1 xerS Tyrosine recombinase XerS Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P55459 1.5e-05 47 22 3 162 3 NGR_a03610 Putative integrase/recombinase y4gC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P62592 1.54e-05 47 24 7 197 3 int Integrase/recombinase Salmonella typhi
P62591 1.54e-05 47 24 7 197 3 int Integrase/recombinase Pseudomonas aeruginosa
P62590 1.54e-05 47 24 7 197 3 int Integrase/recombinase Escherichia coli
A2RKP9 1.65e-05 47 24 4 153 1 xerS Tyrosine recombinase XerS Lactococcus lactis subsp. cremoris (strain MG1363)
Q02YZ4 1.72e-05 47 24 4 153 3 xerS Tyrosine recombinase XerS Lactococcus lactis subsp. cremoris (strain SK11)
C0MFD9 1.85e-05 47 28 4 153 3 xerS Tyrosine recombinase XerS Streptococcus equi subsp. zooepidemicus (strain H70)
B4U2Z3 1.87e-05 47 28 4 153 3 xerS Tyrosine recombinase XerS Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q4UJZ3 2.21e-05 47 24 5 162 3 xerC Tyrosine recombinase XerC Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A8F2V6 2.27e-05 47 24 5 162 3 xerC Tyrosine recombinase XerC Rickettsia massiliae (strain Mtu5)
C0MBC3 2.37e-05 47 28 4 153 3 xerS Tyrosine recombinase XerS Streptococcus equi subsp. equi (strain 4047)
C3PLU8 3.97e-05 46 24 5 162 3 xerC Tyrosine recombinase XerC Rickettsia africae (strain ESF-5)
Q92G55 5.58e-05 45 24 5 162 3 xerC Tyrosine recombinase XerC Rickettsia conorii (strain ATCC VR-613 / Malish 7)
C4K256 0.000112 45 24 5 162 3 xerC Tyrosine recombinase XerC Rickettsia peacockii (strain Rustic)
P0A052 0.000132 45 25 6 188 3 tnpA Transposase A from transposon Tn554 Staphylococcus aureus
P0A051 0.000132 45 25 6 188 3 tnpA1 Transposase A from transposon Tn554 Staphylococcus aureus (strain N315)
P0A050 0.000132 45 25 6 188 3 tnpA1 Transposase A from transposon Tn554 Staphylococcus aureus (strain Mu50 / ATCC 700699)
P22886 0.000147 44 25 5 192 1 Int-Tn Transposase from transposon Tn916 Enterococcus faecalis
P62905 0.000147 44 25 5 192 3 int Transposase from transposon Tn1545 Streptococcus pneumoniae
P62904 0.000147 44 25 5 192 3 int Transposase from transposon Tn1545 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8RA66 0.000153 44 25 5 179 3 xerC Tyrosine recombinase XerC Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A8GTV8 0.000157 44 24 5 162 3 xerC Tyrosine recombinase XerC Rickettsia rickettsii (strain Sheila Smith)
B0BVE6 0.000157 44 24 5 162 3 xerC Tyrosine recombinase XerC Rickettsia rickettsii (strain Iowa)
Q9CG78 0.000186 44 24 4 153 3 xerS Tyrosine recombinase XerS Lactococcus lactis subsp. lactis (strain IL1403)
P55636 0.000189 44 26 7 179 3 NGR_a01840 Putative integrase/recombinase y4rC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q68VT2 0.000447 43 23 5 162 3 xerC Tyrosine recombinase XerC Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P55635 0.001 42 31 1 92 3 NGR_a01850 Putative integrase/recombinase y4rB Sinorhizobium fredii (strain NBRC 101917 / NGR234)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_08955
Feature type CDS
Gene xerD
Product Site-specific recombinase XerD
Location 8204 - 8755 (strand: 1)
Length 552 (nucleotides) / 183 (amino acids)
In genomic island -

Contig

Accession contig_10
Length 146103 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_14
Orthogroup size 19
N. genomes 7

Actions

Genomic region

Domains

PF00589 Phage integrase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4974 Replication, recombination and repair (L) L Site-specific recombinase XerD

Protein Sequence

MKERKHLSEQEVHSLIASLPDSINHIRNQCLIAVCFSHGLRASELTGLMLSDVNIDEKTIHITRLKNGLSTNQPLQSLEYQLLIQWLEQRNASVHYAEPWLFLSRKGGRLSRQQIFRIIRDSGLSADLNIAAHPHMLRHACGYALADRGTDTRLIQDYLGHRNIQHTVLYTASNVARFRSIKL

Flanking regions ( +/- flanking 50bp)

ACGTCAGATAAATAATAAAACCTGACCTTAATAACCATACCGAATATTCCATGAAAGAACGAAAACACCTGAGTGAACAGGAGGTTCATTCCTTAATAGCATCATTACCTGACTCAATTAACCATATTCGTAATCAATGTCTGATTGCCGTTTGTTTCAGTCACGGATTACGGGCCAGTGAACTGACCGGATTAATGCTCAGTGATGTTAATATAGATGAAAAAACCATTCATATTACCCGGCTGAAAAACGGATTAAGCACCAATCAGCCCTTACAGTCCCTTGAATATCAATTACTGATACAGTGGCTGGAACAACGGAATGCATCTGTACATTATGCCGAACCCTGGCTTTTTCTTTCCCGCAAAGGCGGGCGGTTATCCCGCCAGCAAATATTCAGGATTATCCGCGACAGCGGATTGTCCGCCGATCTGAATATTGCGGCACATCCTCATATGCTGCGCCATGCCTGCGGTTATGCATTAGCGGACAGAGGAACAGACACCCGGTTAATTCAGGATTATCTCGGTCACCGTAATATTCAGCACACCGTGTTATATACCGCCAGTAATGTGGCCCGGTTCCGCAGTATTAAATTGTGATTACTGCTCCGTGAAAACCAAAACAGCATTCGCCGTAAAATCCCCGGTTT