Homologs in group_1075

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_09140 EHELCC_09140 100.0 Morganella morganii S2 lysR DNA-binding transcriptional regulator, LysR family
NLDBIP_09520 NLDBIP_09520 100.0 Morganella morganii S4 lysR DNA-binding transcriptional regulator, LysR family
LHKJJB_08235 LHKJJB_08235 100.0 Morganella morganii S3 lysR DNA-binding transcriptional regulator, LysR family
HKOGLL_07785 HKOGLL_07785 100.0 Morganella morganii S5 lysR DNA-binding transcriptional regulator, LysR family
F4V73_RS15815 F4V73_RS15815 98.4 Morganella psychrotolerans - transcriptional regulator GcvA
PMI_RS11365 PMI_RS11365 86.6 Proteus mirabilis HI4320 - transcriptional regulator GcvA

Distribution of the homologs in the orthogroup group_1075

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1075

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A9F6 0.0 526 83 1 300 1 gcvA Glycine cleavage system transcriptional activator Escherichia coli (strain K12)
P0A9F7 0.0 526 83 1 300 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9F8 0.0 526 83 1 300 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O157:H7
P45099 2.18e-94 284 47 2 299 3 gcvA Glycine cleavage system transcriptional activator homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P24734 2.48e-53 179 36 2 290 1 ampR HTH-type transcriptional activator AmpR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P14145 6.48e-52 175 36 3 288 3 ampR HTH-type transcriptional activator AmpR Rhodobacter capsulatus
P52658 9.5e-52 174 36 6 288 3 ampR HTH-type transcriptional activator AmpR Citrobacter koseri
P52660 4e-51 173 34 4 290 3 blaA HTH-type transcriptional regulator BlaA Proteus vulgaris
P52683 7.86e-50 170 34 5 298 3 smeR Carbapenem-hydrolyzing beta-lactamase transcriptional activator Serratia marcescens
O69772 6e-48 165 38 5 289 3 ampR HTH-type transcriptional activator AmpR Providencia stuartii
P52676 2.76e-45 158 33 5 295 3 nmcR Carbapenem-hydrolyzing beta-lactamase transcriptional activator Enterobacter cloacae
P12529 8.4e-42 149 31 2 289 1 ampR HTH-type transcriptional activator AmpR Citrobacter freundii
P05051 5.45e-41 147 31 2 292 3 ampR HTH-type transcriptional activator AmpR Enterobacter cloacae
Q57083 1.23e-39 143 33 6 289 1 perR HTH-type transcriptional regulator PerR Escherichia coli (strain K12)
P45461 1.5e-39 143 32 2 298 3 ampR HTH-type transcriptional activator AmpR Yersinia enterocolitica
P34818 1.4e-38 140 32 6 296 3 trpI HTH-type transcriptional regulator TrpI Pseudomonas syringae pv. syringae
P46068 8.78e-38 139 30 2 295 2 dsdC HTH-type transcriptional regulator DsdC Escherichia coli (strain K12)
P11720 1.44e-34 130 31 8 302 1 trpI HTH-type transcriptional regulator TrpI Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P55576 1.77e-33 127 33 6 286 3 NGR_a02420 Uncharacterized HTH-type transcriptional regulator y4mQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P42507 1.36e-30 119 30 6 296 3 hvrB AhcY transcriptional activator HvrB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P25544 1.55e-24 103 28 7 303 3 rbcR RuBisCO operon transcriptional regulator Allochromatium vinosum
P52595 3.07e-23 100 29 8 279 3 cbbR HTH-type transcriptional regulator CbbR Rhodospirillum rubrum
P37641 6.7e-20 90 25 4 293 3 yhjC Uncharacterized HTH-type transcriptional regulator YhjC Escherichia coli (strain K12)
P30864 8.71e-20 90 26 5 285 3 yafC Uncharacterized HTH-type transcriptional regulator YafC Escherichia coli (strain K12)
Q5N5I5 5.88e-19 89 36 2 138 3 cmpR HTH-type transcriptional activator CmpR Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q9F1R2 5.88e-19 89 36 2 138 1 cmpR HTH-type transcriptional activator CmpR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8X4M5 1.23e-18 87 29 6 222 3 cynR HTH-type transcriptional regulator CynR Escherichia coli O157:H7
Q55459 2.11e-18 87 37 2 145 1 cmpR HTH-type transcriptional activator CmpR Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P76250 5.03e-18 85 31 5 258 1 dmlR HTH-type transcriptional regulator DmlR Escherichia coli (strain K12)
P42722 1.42e-17 84 39 3 129 3 cfxR HTH-type transcriptional regulator CfxR Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P27111 1.72e-17 84 30 5 216 1 cynR HTH-type transcriptional regulator CynR Escherichia coli (strain K12)
A0T0G2 3.79e-17 83 27 8 259 3 rbcR Probable RuBisCO transcriptional regulator Phaeodactylum tricornutum (strain CCAP 1055/1)
A0A0H2ZDG9 3.16e-16 80 25 5 301 3 PA14_22550 HTH-type transcriptional repressor PA14_22550 Pseudomonas aeruginosa (strain UCBPP-PA14)
P67662 5.15e-16 80 27 2 250 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli (strain K12)
P67663 5.15e-16 80 27 2 250 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P67664 5.15e-16 80 27 2 250 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli O157:H7
Q8YQ82 1.96e-15 79 30 11 305 3 rbcR Probable RuBisCO transcriptional regulator Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3MCB5 2.47e-15 78 30 11 305 3 rbcR Probable RuBisCO transcriptional regulator Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q9JPU9 5.16e-15 77 26 5 253 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup C (strain 8013)
Q9JXW7 7.61e-15 77 26 5 253 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q57748 2.55e-14 75 25 10 300 3 MJ0300 Uncharacterized HTH-type transcriptional regulator MJ0300 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A0T0V5 9.57e-14 73 34 8 179 3 rbcR-A Probable RuBisCO transcriptional regulator Thalassiosira pseudonana
P43011 2.12e-13 72 23 3 256 3 HI_1364 Uncharacterized HTH-type transcriptional regulator HI_1364 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P96725 3.37e-13 72 25 6 257 3 ywqM Uncharacterized HTH-type transcriptional regulator YwqM Bacillus subtilis (strain 168)
P39592 6.52e-13 71 29 3 172 3 ywbI Uncharacterized HTH-type transcriptional regulator YwbI Bacillus subtilis (strain 168)
O78432 1.86e-12 70 33 2 124 3 rbcR Probable RuBisCO transcriptional regulator Guillardia theta
Q06610 3.45e-12 69 25 9 311 3 rbcR RuBisCO operon transcriptional regulator Acidithiobacillus ferrooxidans
P75836 3.56e-12 69 25 5 289 3 ycaN Uncharacterized HTH-type transcriptional regulator YcaN Escherichia coli (strain K12)
O07906 3.99e-12 68 26 6 183 3 yraN Uncharacterized HTH-type transcriptional regulator YraN Bacillus subtilis (strain 168)
P49518 7.16e-12 68 34 7 153 3 rbcR Probable RuBisCO transcriptional regulator Trieres chinensis
P55181 7.26e-12 68 28 6 195 3 yxjO Uncharacterized HTH-type transcriptional regulator YxjO Bacillus subtilis (strain 168)
Q85G62 1.03e-11 67 36 3 125 3 rbcR Probable RuBisCO transcriptional regulator Cyanidioschyzon merolae (strain NIES-3377 / 10D)
P52666 1.27e-11 67 35 2 122 3 budR HTH-type transcriptional regulator BudR Raoultella terrigena
P72131 1.49e-11 67 24 7 286 1 ptxR HTH-type transcriptional regulator PtxR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P73123 1.78e-11 67 27 13 311 3 rbcR Probable RuBisCO transcriptional regulator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O34827 1.79e-11 67 24 8 272 3 ykuM Uncharacterized HTH-type transcriptional regulator YkuM Bacillus subtilis (strain 168)
P52665 2.03e-11 64 38 1 98 3 budR HTH-type transcriptional regulator BudR (Fragment) Klebsiella aerogenes
P94387 4.11e-11 66 33 3 134 3 ycgK Uncharacterized HTH-type transcriptional regulator YcgK Bacillus subtilis (strain 168)
P45463 5.57e-11 65 25 6 261 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli (strain K12)
O34685 5.67e-11 65 29 2 142 1 yofA HTH-type transcriptional regulator YofA Bacillus subtilis (strain 168)
Q0TD46 5.79e-11 65 25 6 261 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1R6S1 6.66e-11 65 25 6 261 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli (strain UTI89 / UPEC)
Q8FDH0 6.66e-11 65 25 6 261 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P48271 6.81e-11 65 36 8 152 3 rbcR Probable RuBisCO transcriptional regulator Cyanophora paradoxa
Q04778 7.05e-11 65 27 4 163 3 alsR HTH-type transcriptional regulator AlsR Bacillus subtilis (strain 168)
Q6B936 7.41e-11 65 33 2 124 3 rbcR Probable RuBisCO transcriptional regulator Gracilaria tenuistipitata var. liui
Q8XBK9 8.5e-11 65 25 6 261 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O157:H7
P77559 1.13e-10 64 31 2 130 3 ynfL Uncharacterized HTH-type transcriptional regulator YnfL Escherichia coli (strain K12)
P52689 1.22e-10 64 28 2 149 3 ltrA Probable HTH-type transcriptional regulator LtrA Klebsiella pneumoniae
O32186 1.36e-10 64 24 6 270 3 yusT Uncharacterized HTH-type transcriptional regulator YusT Bacillus subtilis (strain 168)
Q1XDT2 2.88e-10 63 33 2 124 3 rbcR Probable RuBisCO transcriptional regulator Neopyropia yezoensis
P51205 3.38e-10 63 33 2 124 3 rbcR Probable RuBisCO transcriptional regulator Porphyra purpurea
Q8KA72 3.6e-10 63 30 1 118 3 metR HTH-type transcriptional regulator MetR Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P77744 4.07e-10 63 26 5 189 3 abgR HTH-type transcriptional regulator AbgR Escherichia coli (strain K12)
P20668 1.17e-09 61 28 3 175 1 gltC Transcriptional dual regulator GltC Bacillus subtilis (strain 168)
P05827 1.26e-09 61 25 6 256 3 ilvY HTH-type transcriptional regulator IlvY Escherichia coli (strain K12)
O34701 1.44e-09 61 27 5 171 3 yoaU Uncharacterized HTH-type transcriptional regulator YoaU Bacillus subtilis (strain 168)
P0ACR8 1.86e-09 61 26 3 169 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Shigella flexneri
P0ACR7 1.86e-09 61 26 3 169 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Escherichia coli (strain K12)
P0A2Q2 2.15e-09 60 25 7 257 3 ilvY HTH-type transcriptional activator IlvY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q3 2.15e-09 60 25 7 257 3 ilvY HTH-type transcriptional activator IlvY Salmonella typhi
P52696 2.71e-09 60 27 1 122 3 ybhD Uncharacterized HTH-type transcriptional regulator YbhD Escherichia coli (strain K12)
Q9X5P2 3.96e-09 60 30 1 128 2 oxyR Probable hydrogen peroxide-inducible genes activator Streptomyces viridosporus
P39376 6.95e-09 59 26 8 251 1 yjiE HTH-type transcriptional regulator YjiE Escherichia coli (strain K12)
Q01610 8.74e-09 59 26 5 267 3 PA2220 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O32255 1.11e-08 58 33 3 121 3 yvbU Uncharacterized HTH-type transcriptional regulator YvbU Bacillus subtilis (strain 168)
Q44311 1.19e-08 58 26 4 162 3 soxR HTH-type transcriptional regulator SoxR Arthrobacter sp. (strain TE1826)
P94501 1.23e-08 58 28 2 166 1 gltR HTH-type transcriptional regulator GltR Bacillus subtilis (strain 168)
Q9HWH8 1.34e-08 58 25 2 168 3 nmoR HTH-type transcriptional regulator NmoR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O06703 1.39e-08 58 26 11 272 3 bbuR HTH-type transcriptional regulator BbuR Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P0A9G1 1.55e-08 58 31 2 117 3 metR HTH-type transcriptional regulator MetR Shigella flexneri
P0A9F9 1.55e-08 58 31 2 117 1 metR HTH-type transcriptional regulator MetR Escherichia coli (strain K12)
P0A9G0 1.55e-08 58 31 2 117 3 metR HTH-type transcriptional regulator MetR Escherichia coli O157:H7
Q47141 1.76e-08 58 30 4 169 1 hcaR Hca operon transcriptional activator HcaR Escherichia coli (strain K12)
O19892 1.93e-08 58 33 3 125 3 rbcR Probable RuBisCO transcriptional regulator Cyanidium caldarium
Q4G384 2.07e-08 58 29 5 147 3 rbcR Probable RuBisCO transcriptional regulator Emiliania huxleyi
P52669 2.69e-08 57 28 1 118 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
P37499 2.87e-08 57 30 3 121 3 yybE Uncharacterized HTH-type transcriptional regulator YybE Bacillus subtilis (strain 168)
Q6HPH4 3.19e-08 57 28 2 128 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H01 3.84e-08 57 28 3 150 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ZK / E33L)
Q73EY2 3.84e-08 57 28 3 150 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81VJ1 4.02e-08 57 28 3 150 3 czcR HTH-type transcriptional regulator CzcR Bacillus anthracis
Q81IX0 4.13e-08 57 28 2 128 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q765S2 4.55e-08 56 38 0 80 3 allS HTH-type transcriptional activator AllS Klebsiella pneumoniae
A0R8S0 4.67e-08 57 27 3 166 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis (strain Al Hakam)
P25545 4.81e-08 57 26 8 257 3 cbbR HTH-type transcriptional regulator CbbR Xanthobacter flavus
A7Z5E4 5.31e-08 56 27 2 160 3 yofA HTH-type transcriptional regulator YofA Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P0A4T7 8.11e-08 56 26 3 160 3 pcaQ HTH-type transcriptional regulator PcaQ Rhizobium radiobacter
P0A4T6 8.11e-08 56 26 3 160 3 pcaQ HTH-type transcriptional regulator PcaQ Agrobacterium fabrum (strain C58 / ATCC 33970)
P45349 9.48e-08 56 29 1 108 3 metR HTH-type transcriptional regulator MetR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P52662 9.52e-08 56 32 0 120 3 pecT HTH-type transcriptional regulator PecT Dickeya dadantii (strain 3937)
P33634 9.95e-08 55 27 5 158 3 yfiE Uncharacterized HTH-type transcriptional regulator YfiE Escherichia coli (strain K12)
P36771 1.06e-07 55 34 1 123 1 lrhA Probable HTH-type transcriptional regulator LrhA Escherichia coli (strain K12)
Q8VWE6 1.07e-07 55 34 1 123 3 lrhA Probable HTH-type transcriptional regulator LrhA Escherichia coli O157:H7
P0ACR2 1.43e-07 55 24 9 274 3 ydhB Uncharacterized HTH-type transcriptional regulator YdhB Escherichia coli (strain K12)
P0ACR3 1.43e-07 55 24 9 274 3 ydhB Uncharacterized HTH-type transcriptional regulator YdhB Escherichia coli O157:H7
O87883 1.44e-07 54 28 4 180 3 oxyR Probable hydrogen peroxide-inducible genes activator (Fragment) Mycobacterium xenopi
P0A2Q4 1.54e-07 55 30 2 120 3 metR HTH-type transcriptional regulator MetR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q5 1.54e-07 55 30 2 120 3 metR HTH-type transcriptional regulator MetR Salmonella typhi
P52693 2.16e-07 55 28 8 192 3 ntcB Probable nitrogen assimilation transcriptional activator Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P58508 2.74e-07 54 24 8 258 3 argP HTH-type transcriptional regulator ArgP Salmonella typhi
P77700 2.89e-07 54 46 0 60 1 yahB Uncharacterized HTH-type transcriptional regulator YahB Escherichia coli (strain K12)
P52670 3.19e-07 54 30 2 120 3 ilvR HTH-type transcriptional regulator IlvR Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P58509 3.85e-07 54 24 8 258 3 argP HTH-type transcriptional regulator ArgP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TV33 3.85e-07 54 24 8 258 3 argP HTH-type transcriptional regulator ArgP Salmonella schwarzengrund (strain CVM19633)
B5BFM9 3.85e-07 54 24 8 258 3 argP HTH-type transcriptional regulator ArgP Salmonella paratyphi A (strain AKU_12601)
C0PY38 3.85e-07 54 24 8 258 3 argP HTH-type transcriptional regulator ArgP Salmonella paratyphi C (strain RKS4594)
A9N3P8 3.85e-07 54 24 8 258 3 argP HTH-type transcriptional regulator ArgP Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJH0 3.85e-07 54 24 8 258 3 argP HTH-type transcriptional regulator ArgP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T5G4 3.85e-07 54 24 8 258 3 argP HTH-type transcriptional regulator ArgP Salmonella newport (strain SL254)
B4THE6 3.85e-07 54 24 8 258 3 argP HTH-type transcriptional regulator ArgP Salmonella heidelberg (strain SL476)
Q57K51 3.85e-07 54 24 8 258 3 argP HTH-type transcriptional regulator ArgP Salmonella choleraesuis (strain SC-B67)
B5F5I9 3.85e-07 54 24 8 258 3 argP HTH-type transcriptional regulator ArgP Salmonella agona (strain SL483)
A9MRG1 4.04e-07 54 24 8 258 3 argP HTH-type transcriptional regulator ArgP Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
O68014 4.57e-07 53 30 3 122 1 benM HTH-type transcriptional regulator BenM Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B5RE25 4.98e-07 53 24 8 258 3 argP HTH-type transcriptional regulator ArgP Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXJ1 4.98e-07 53 24 8 258 3 argP HTH-type transcriptional regulator ArgP Salmonella enteritidis PT4 (strain P125109)
B5FUH7 4.98e-07 53 24 8 258 3 argP HTH-type transcriptional regulator ArgP Salmonella dublin (strain CT_02021853)
A8APC5 4.98e-07 53 23 8 261 3 argP HTH-type transcriptional regulator ArgP Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P94403 5.13e-07 53 30 2 119 3 bsdA HTH-type transcriptional regulator BsdA Bacillus subtilis (strain 168)
P16931 5.19e-07 53 29 0 120 3 dgdR HTH-type transcriptional regulator DgdR Burkholderia cepacia
P71025 5.94e-07 53 27 2 128 3 czcR HTH-type transcriptional regulator CzcR Bacillus subtilis (strain 168)
Q47083 8.62e-07 53 28 4 132 1 cbl HTH-type transcriptional regulator cbl Escherichia coli (strain K12)
P77333 8.88e-07 53 27 2 141 1 pgrR HTH-type transcriptional regulator PgrR Escherichia coli (strain K12)
Q7N185 1.4e-06 52 23 6 257 3 argP HTH-type transcriptional regulator ArgP Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P39127 1.51e-06 52 42 0 59 3 citR HTH-type transcriptional regulator CitR Bacillus subtilis (strain 168)
P0ACQ9 1.62e-06 52 28 2 125 3 tdcA HTH-type transcriptional regulator TdcA Shigella flexneri
P0ACQ7 1.62e-06 52 28 2 125 3 tdcA HTH-type transcriptional regulator TdcA Escherichia coli (strain K12)
P0ACQ8 1.62e-06 52 28 2 125 3 tdcA HTH-type transcriptional regulator TdcA Escherichia coli O157:H7
P96194 1.64e-06 50 36 1 96 3 None Uncharacterized HTH-type transcriptional regulator in ibpB-leuC intergenic region Azotobacter vinelandii
P52686 2.01e-06 52 25 13 312 3 sdsB SDS degradation transcriptional activation protein Pseudomonas sp. (strain ATCC 19151)
P77171 2.46e-06 52 26 4 174 3 ydcI Uncharacterized HTH-type transcriptional regulator YdcI Escherichia coli (strain K12)
Q8FK66 2.86e-06 51 37 0 79 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKD7 2.86e-06 51 37 0 79 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B2TU26 3.72e-06 51 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B4F0Q1 3.76e-06 51 24 7 257 3 argP HTH-type transcriptional regulator ArgP Proteus mirabilis (strain HI4320)
P20667 4.13e-06 51 36 3 98 3 catR HTH-type transcriptional regulator CatR Pseudomonas putida
O35038 4.99e-06 50 32 3 127 3 ytlI HTH-type transcriptional regulator YtlI Bacillus subtilis (strain 168)
P0ACQ4 5.06e-06 50 25 1 120 1 oxyR DNA-binding transcriptional dual regulator OxyR Escherichia coli (strain K12)
P0ACQ5 5.06e-06 50 25 1 120 3 oxyR Hydrogen peroxide-inducible genes activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACQ6 5.06e-06 50 25 1 120 3 oxyR Hydrogen peroxide-inducible genes activator Escherichia coli O157:H7
A6TDS6 5.47e-06 50 24 8 264 3 argP HTH-type transcriptional regulator ArgP Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P0ACR0 5.56e-06 50 37 0 79 1 allS HTH-type transcriptional activator AllS Escherichia coli (strain K12)
P0ACR1 5.56e-06 50 37 0 79 3 allS HTH-type transcriptional activator AllS Escherichia coli O157:H7
B7NU32 5.72e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P39647 5.77e-06 50 25 4 171 1 cysL HTH-type transcriptional regulator CysL Bacillus subtilis (strain 168)
B7NF72 6.04e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q3YVK2 6.33e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Shigella sonnei (strain Ss046)
P0A8S0 6.33e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Shigella flexneri
Q0SYV7 6.33e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Shigella flexneri serotype 5b (strain 8401)
Q31UM0 6.33e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Shigella boydii serotype 4 (strain Sb227)
B1LLU0 6.33e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain SMS-3-5 / SECEC)
P0A8R9 6.33e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12)
B1IWY2 6.33e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A6M0 6.33e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O9:H4 (strain HS)
B1X9Y2 6.33e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12 / DH10B)
C4ZZ35 6.33e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12 / MC4100 / BW2952)
B7UMM1 6.33e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q329U3 6.39e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Shigella dysenteriae serotype 1 (strain Sd197)
B6I4A0 6.39e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain SE11)
B7M5B2 6.39e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O8 (strain IAI1)
B5YY14 6.39e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAW1 6.39e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O157:H7
B7L8A6 6.39e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain 55989 / EAEC)
A7ZTW7 6.39e-06 50 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O139:H28 (strain E24377A / ETEC)
A4WE66 6.5e-06 50 23 6 257 3 argP HTH-type transcriptional regulator ArgP Enterobacter sp. (strain 638)
O33812 7.95e-06 50 29 3 130 3 None Uncharacterized HTH-type transcriptional regulator in lacR 5'region (Fragment) Staphylococcus xylosus
Q9X725 8.51e-06 50 27 3 118 3 oxyR Hydrogen peroxide-inducible genes activator Dickeya chrysanthemi
Q1RF30 8.84e-06 50 36 0 79 3 allS HTH-type transcriptional activator AllS Escherichia coli (strain UTI89 / UPEC)
A1A8H0 8.84e-06 50 36 0 79 3 allS HTH-type transcriptional activator AllS Escherichia coli O1:K1 / APEC
P67660 9.49e-06 50 26 8 298 1 yhaJ Probable HTH-type transcriptional regulator YhaJ Escherichia coli (strain K12)
P67661 9.49e-06 50 26 8 298 1 yhaJ HTH-type transcriptional regulator YhaJ Escherichia coli O157:H7
B5XUC3 9.71e-06 50 24 8 264 3 argP HTH-type transcriptional regulator ArgP Klebsiella pneumoniae (strain 342)
B7NHX5 9.98e-06 50 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O7:K1 (strain IAI39 / ExPEC)
O33945 1.29e-05 49 23 5 173 3 None Probable cat1 operon transcriptional activator Acinetobacter lwoffii
A2CI69 1.32e-05 49 30 6 148 3 rbcR Probable RuBisCO transcriptional regulator Chlorokybus atmophyticus
Q3YXV6 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Shigella sonnei (strain Ss046)
P0A8S4 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Shigella flexneri
Q0T0Y4 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Shigella flexneri serotype 5b (strain 8401)
Q32BX8 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Shigella dysenteriae serotype 1 (strain Sd197)
Q31WH5 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Shigella boydii serotype 4 (strain Sb227)
B2U0T2 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R7B4 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli (strain UTI89 / UPEC)
B1LDC0 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli (strain SMS-3-5 / SECEC)
B6I748 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli (strain SE11)
B7N7G1 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8S1 1.41e-05 49 24 9 264 1 argP HTH-type transcriptional regulator ArgP Escherichia coli (strain K12)
B1IT87 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8S2 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TDT7 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A456 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O9:H4 (strain HS)
B1XEK1 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli (strain K12 / DH10B)
C5A0I6 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli (strain K12 / MC4100 / BW2952)
B7LYT3 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O8 (strain IAI1)
B7MZ67 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O81 (strain ED1a)
B5YQA9 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8S3 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O157:H7
B7LFH3 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli (strain 55989 / EAEC)
B7MMA1 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UHW2 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZR24 1.41e-05 49 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O139:H28 (strain E24377A / ETEC)
O52399 1.44e-05 49 26 13 267 3 argP HTH-type transcriptional regulator ArgP Edwardsiella ictaluri (strain 93-146)
Q46M54 1.45e-05 49 26 2 187 1 tfdS HTH-type transcriptional regulator TfdS Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A7MR91 1.52e-05 49 24 8 258 3 argP HTH-type transcriptional regulator ArgP Cronobacter sakazakii (strain ATCC BAA-894)
Q46M57 1.55e-05 49 26 2 187 1 tfdR HTH-type transcriptional regulator TdfR Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P0A4T3 1.84e-05 49 28 3 126 1 occR Octopine catabolism/uptake operon regulatory protein OccR Rhizobium radiobacter
P0A4T4 1.84e-05 49 28 3 126 1 occR Octopine catabolism/uptake operon regulatory protein OccR Agrobacterium tumefaciens (strain Ach5)
P74422 1.97e-05 48 27 5 189 3 ntcB Probable nitrogen assimilation transcriptional activator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P44821 2.01e-05 48 25 4 181 3 ilvY HTH-type transcriptional activator IlvY Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B7LUJ5 2.02e-05 48 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P71318 2.11e-05 48 26 3 118 3 oxyR Hydrogen peroxide-inducible genes activator Pectobacterium carotovorum subsp. carotovorum
Q1R4H3 2.13e-05 48 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain UTI89 / UPEC)
P59369 2.13e-05 48 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAV4 2.13e-05 48 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N260 2.13e-05 48 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O81 (strain ED1a)
B7MGH6 2.13e-05 48 31 4 129 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O45:K1 (strain S88 / ExPEC)
P45600 2.97e-05 48 27 4 126 1 cysB HTH-type transcriptional regulator CysB Klebsiella pneumoniae
B7LPC9 2.97e-05 48 24 9 264 3 argP HTH-type transcriptional regulator ArgP Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P03030 3.33e-05 48 25 8 261 3 lysR Transcriptional activator protein LysR Escherichia coli (strain K12)
P0A9F3 3.56e-05 48 26 4 126 3 cysB HTH-type transcriptional regulator CysB Escherichia coli (strain K12)
P0A9F4 3.56e-05 48 26 4 126 3 cysB HTH-type transcriptional regulator CysB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9F5 3.56e-05 48 26 4 126 3 cysB HTH-type transcriptional regulator CysB Escherichia coli O157:H7
P44876 4.89e-05 47 26 3 132 3 HI_0775 Uncharacterized HTH-type transcriptional regulator HI_0775 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P07774 5e-05 47 26 5 163 1 catM HTH-type transcriptional regulator CatM Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P06614 5.02e-05 47 26 4 126 1 cysB HTH-type transcriptional regulator CysB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P25547 6.66e-05 47 26 3 125 3 gbpR HTH-type transcriptional regulator GbpR Rhizobium radiobacter
Q9S4Y7 7.24e-05 47 45 0 57 3 allS HTH-type transcriptional activator AllS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PCH2 7.24e-05 47 45 0 57 3 allS HTH-type transcriptional activator AllS Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57S50 8.38e-05 47 45 0 57 3 allS HTH-type transcriptional activator AllS Salmonella choleraesuis (strain SC-B67)
P52659 8.71e-05 47 23 6 297 3 abaB HTH-type transcriptional regulator AbaB Streptomyces antibioticus
Q2NRD9 9.79e-05 47 22 7 257 3 argP HTH-type transcriptional regulator ArgP Sodalis glossinidius (strain morsitans)
A1JI47 0.000103 47 31 1 103 3 hdfR HTH-type transcriptional regulator HdfR Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B4SYF7 0.000113 46 34 1 83 3 hdfR HTH-type transcriptional regulator HdfR Salmonella newport (strain SL254)
B4TNR5 0.000116 46 34 1 83 3 hdfR HTH-type transcriptional regulator HdfR Salmonella schwarzengrund (strain CVM19633)
B5FN59 0.000121 46 34 1 83 3 hdfR HTH-type transcriptional regulator HdfR Salmonella dublin (strain CT_02021853)
P0A2Q0 0.000123 46 34 1 83 3 hdfR HTH-type transcriptional regulator HdfR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q1 0.000123 46 34 1 83 3 hdfR HTH-type transcriptional regulator HdfR Salmonella typhi
B5BIR0 0.000123 46 34 1 83 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi A (strain AKU_12601)
C0Q2U0 0.000123 46 34 1 83 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi C (strain RKS4594)
A9MXD5 0.000123 46 34 1 83 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJZ0 0.000123 46 34 1 83 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TAZ8 0.000123 46 34 1 83 3 hdfR HTH-type transcriptional regulator HdfR Salmonella heidelberg (strain SL476)
B5EZ22 0.000123 46 34 1 83 3 hdfR HTH-type transcriptional regulator HdfR Salmonella agona (strain SL483)
P70785 0.00014 46 37 0 70 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
P77309 0.000143 46 25 0 116 3 yneJ Uncharacterized HTH-type transcriptional regulator YneJ Escherichia coli (strain K12)
Q8Z8R3 0.000169 46 45 0 57 3 allS HTH-type transcriptional activator AllS Salmonella typhi
P52661 0.000173 46 26 2 136 1 gbpR HTH-type transcriptional regulator GbpR Azospirillum brasilense
A1JPP6 0.000187 46 23 8 272 3 argP HTH-type transcriptional regulator ArgP Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VF18 0.000205 45 22 6 257 3 argP HTH-type transcriptional regulator ArgP Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
P0ACR4 0.000225 45 23 7 255 1 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli (strain K12)
P0ACR5 0.000225 45 23 7 255 3 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACR6 0.000225 45 23 7 255 3 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli O157:H7
Q6LMN6 0.000233 45 23 9 272 3 argP HTH-type transcriptional regulator ArgP Photobacterium profundum (strain SS9)
Q00678 0.000235 45 25 2 153 3 nocR Regulatory protein NocR Agrobacterium fabrum (strain C58 / ATCC 33970)
B1JQ39 0.000275 45 30 1 103 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G51 0.000275 45 30 1 103 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRF4 0.000275 45 30 1 103 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis (strain Pestoides F)
Q1CNN4 0.000275 45 30 1 103 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Nepal516)
A9R8E7 0.000275 45 30 1 103 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAA7 0.000275 45 30 1 103 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis
B2JZG4 0.000275 45 30 1 103 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBT5 0.000275 45 30 1 103 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Antiqua)
A7FD20 0.000275 45 30 1 103 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P52667 0.000296 45 25 3 170 3 estR HTH-type transcriptional regulator EstR Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P44418 0.000318 45 25 3 120 3 oxyR Hydrogen peroxide-inducible genes activator Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q6D092 0.000322 45 22 6 257 3 argP HTH-type transcriptional regulator ArgP Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P72294 0.000386 45 31 3 109 3 occR Octopine catabolism/uptake operon regulatory protein OccR Rhizobium meliloti
C6DF35 0.000415 45 22 6 257 3 argP HTH-type transcriptional regulator ArgP Pectobacterium carotovorum subsp. carotovorum (strain PC1)
P67668 0.000454 45 39 0 66 3 BQ2027_MB2303C Uncharacterized HTH-type transcriptional regulator Mb2303c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMF3 0.000454 45 39 0 66 1 Rv2282c Uncharacterized HTH-type transcriptional regulator Rv2282c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMF2 0.000454 45 39 0 66 3 MT2340 Uncharacterized HTH-type transcriptional regulator MT2340 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P52692 0.000491 44 45 0 59 3 nhaR Transcriptional activator protein NhaR Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B4E8S9 0.000505 44 38 1 59 1 ssuR HTH-type transcriptional regulator SsuR Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
P35112 0.00052 44 25 2 141 3 nocR Regulatory protein NocR Agrobacterium tumefaciens (strain T37)
B1JNR6 0.000528 44 23 8 258 3 argP HTH-type transcriptional regulator ArgP Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q666Q6 0.000528 44 23 8 258 3 argP HTH-type transcriptional regulator ArgP Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TI95 0.000528 44 23 8 258 3 argP HTH-type transcriptional regulator ArgP Yersinia pestis (strain Pestoides F)
Q1CEY8 0.000528 44 23 8 258 3 argP HTH-type transcriptional regulator ArgP Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4J7 0.000528 44 23 8 258 3 argP HTH-type transcriptional regulator ArgP Yersinia pestis bv. Antiqua (strain Angola)
P58510 0.000528 44 23 8 258 3 argP HTH-type transcriptional regulator ArgP Yersinia pestis
B2K0R5 0.000528 44 23 8 258 3 argP HTH-type transcriptional regulator ArgP Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CB53 0.000528 44 23 8 258 3 argP HTH-type transcriptional regulator ArgP Yersinia pestis bv. Antiqua (strain Antiqua)
A7FF10 0.000528 44 23 8 258 3 argP HTH-type transcriptional regulator ArgP Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P56885 0.000531 44 21 13 306 3 cbbR HTH-type transcriptional regulator CbbR Sinorhizobium medicae (strain WSM419)
B4E8V9 0.000561 44 27 2 118 1 cysB HTH-type transcriptional regulator CysB Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A5F9F1 0.00079 44 21 9 305 3 argP HTH-type transcriptional regulator ArgP Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P52678 0.000792 44 26 1 124 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium leprae (strain TN)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_06095
Feature type CDS
Gene lysR
Product DNA-binding transcriptional regulator, LysR family
Location 43057 - 43983 (strand: -1)
Length 927 (nucleotides) / 308 (amino acids)

Contig

Accession contig_6
Length 178871 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1075
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00126 Bacterial regulatory helix-turn-helix protein, lysR family
PF03466 LysR substrate binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0583 Transcription (K) K DNA-binding transcriptional regulator, LysR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03566 LysR family transcriptional regulator, glycine cleavage system transcriptional activator Biofilm formation - Escherichia coli -

Protein Sequence

MSKRLPPLNALRVFDAAARHLSFTKAAEELFVTQAAVSHQMKSLEDFLGLKLFRRRNRSLLLTEEGQSYYLDIKEIFSAINDATRKLQARSAKGALTVSLSPSFAIQWLVPRLSGFHQAYPGIDVRIQAVDREEDKLADDVDVAIFYGRGNWPGLRTDRLYAEYLIPVCAPSLMTGERPLKTLTDLSYHTLLHDSSRRDWQAYIRQADLQQQVNVQHGPIFSHSAMVIQAAVHGQGVALVNNVMAKNELDAGRLVCPFKDILVSKNAFYLVCQDSQADSGKIAAFRQWIMAQAASEQEKLGWMTSEQD

Flanking regions ( +/- flanking 50bp)

CCGACTAAACTTACGTTACCGGTATCCGGATCTGACAGAAAAACCAGAAAATGTCCAAACGATTGCCTCCGCTCAATGCTTTGCGTGTCTTCGATGCTGCCGCCCGCCATTTAAGTTTTACTAAGGCGGCGGAAGAGCTTTTTGTGACTCAGGCCGCAGTGAGCCATCAGATGAAAAGCCTGGAAGATTTCCTCGGGCTGAAATTATTCCGCCGCCGGAACCGTTCGTTGTTGCTGACGGAAGAGGGGCAGAGTTATTATCTCGATATTAAGGAAATCTTCTCAGCGATAAACGACGCCACACGCAAACTCCAGGCACGCAGTGCCAAAGGGGCGCTGACAGTCAGTCTGTCACCGAGTTTCGCGATCCAGTGGCTGGTGCCGCGTCTGTCCGGCTTTCATCAGGCCTATCCGGGCATTGATGTGCGGATCCAGGCGGTTGACCGCGAAGAAGATAAACTGGCCGATGATGTGGATGTGGCGATTTTTTACGGCAGGGGTAACTGGCCGGGTCTGCGTACAGACCGGCTGTATGCGGAATATCTGATCCCGGTGTGCGCGCCGTCACTGATGACCGGTGAACGGCCGCTCAAAACGCTGACCGATTTGTCGTATCATACACTTCTGCATGATTCATCCCGCCGTGACTGGCAGGCGTATATCCGTCAGGCGGATTTGCAGCAGCAGGTTAATGTGCAGCACGGGCCGATTTTCAGCCACAGTGCGATGGTGATTCAGGCCGCAGTGCACGGGCAGGGCGTGGCACTGGTCAATAATGTTATGGCAAAAAATGAACTGGATGCCGGTCGCCTGGTGTGCCCGTTTAAAGATATTCTGGTCAGTAAGAATGCGTTTTATCTGGTGTGTCAGGACAGTCAGGCTGATTCCGGTAAAATCGCAGCATTCCGTCAGTGGATTATGGCGCAGGCGGCGAGTGAACAGGAAAAACTAGGTTGGATGACAAGTGAGCAGGATTAACCTGAACTTCACATAAGGTATGGCAAATGAATAGTCGGTTGATGTTAATT