Homologs in group_3253

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_12040 EHELCC_12040 100.0 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_12380 NLDBIP_12380 100.0 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_12240 LHKJJB_12240 100.0 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_10855 HKOGLL_10855 100.0 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain

Distribution of the homologs in the orthogroup group_3253

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3253

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0C5S2 2.59e-08 51 39 0 68 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 2.59e-08 51 39 0 68 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
P15017 1.49e-07 49 33 0 78 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
P55681 3.72e-07 48 31 0 70 4 NGR_a01020 Uncharacterized HTH-type transcriptional regulator y4wC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9ZD50 5.6e-06 45 35 0 73 4 RP497 Uncharacterized HTH-type transcriptional regulator RP497 Rickettsia prowazekii (strain Madrid E)
Q92HV3 2.22e-05 43 34 0 73 4 RC0668 Uncharacterized HTH-type transcriptional regulator RC0668 Rickettsia conorii (strain ATCC VR-613 / Malish 7)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_05550
Feature type CDS
Gene hipB
Product Transcriptional regulator, contains XRE-family HTH domain
Location 118648 - 118989 (strand: 1)
Length 342 (nucleotides) / 113 (amino acids)
In genomic island -

Contig

Accession contig_5
Length 181448 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3253
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MNEREISLFIGQQISRKRKSLGLSGMALAELLGLSQQQISRYEQGITNIRASTLLQIAFLFNVDVKSFFTDCIEKNSKLSSLNYKEKKSQETDYDTITIDMKSRGRGKIRSKK

Flanking regions ( +/- flanking 50bp)

AATTACTATATTTAAGATTACACACAGCTTTTAATTTAAGGGCATAGCATATGAATGAGAGAGAAATCAGCCTCTTTATCGGTCAGCAAATTTCACGGAAAAGAAAATCGCTGGGATTATCAGGTATGGCACTTGCCGAATTACTGGGTTTAAGTCAGCAGCAAATATCCCGCTATGAACAGGGCATTACCAATATAAGAGCCAGTACATTACTGCAAATCGCTTTTTTGTTTAATGTTGATGTAAAAAGTTTTTTTACTGATTGTATCGAAAAAAACAGCAAACTGAGTTCACTTAACTATAAAGAGAAAAAGAGTCAGGAAACAGACTATGACACGATCACTATTGATATGAAGAGCAGAGGAAGGGGTAAAATCCGCAGTAAAAAATAACCATACCAGAGAGTACCAGCAGCCCGCCCCCGTCATCCCGGATCATTCCG