Homologs in group_1032

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_12280 EHELCC_12280 100.0 Morganella morganii S2 dppB ABC-type dipeptide/oligopeptide/nickel transport system, permease component
NLDBIP_12620 NLDBIP_12620 100.0 Morganella morganii S4 dppB ABC-type dipeptide/oligopeptide/nickel transport system, permease component
LHKJJB_12480 LHKJJB_12480 100.0 Morganella morganii S3 dppB ABC-type dipeptide/oligopeptide/nickel transport system, permease component
HKOGLL_11095 HKOGLL_11095 100.0 Morganella morganii S5 dppB ABC-type dipeptide/oligopeptide/nickel transport system, permease component
F4V73_RS05765 F4V73_RS05765 91.1 Morganella psychrotolerans - ABC transporter permease
PMI_RS07170 PMI_RS07170 72.3 Proteus mirabilis HI4320 - ABC transporter permease

Distribution of the homologs in the orthogroup group_1032

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1032

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A0A0H2ZGW7 1.4e-73 234 40 2 321 1 dppB Di/tripeptide transport system permease protein DppB Pseudomonas aeruginosa (strain UCBPP-PA14)
P0AEF8 3.23e-67 218 37 2 322 1 dppB Dipeptide transport system permease protein DppB Escherichia coli (strain K12)
P0AEF9 3.23e-67 218 37 2 322 3 dppB Dipeptide transport system permease protein DppB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEG0 3.23e-67 218 37 2 322 3 dppB Dipeptide transport system permease protein DppB Escherichia coli O157:H7
P77308 2.57e-65 213 40 1 327 1 ddpB Probable D,D-dipeptide transport system permease protein DdpB Escherichia coli (strain K12)
P45096 1.59e-64 210 36 4 335 3 dppB Dipeptide transport system permease protein DppB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q2YJK1 6.99e-58 192 36 3 314 3 BAB2_1050 Putative peptide transport system permease protein BAB2_1050 Brucella abortus (strain 2308)
Q8VQK4 6.99e-58 192 36 3 314 3 BruAb2_1031 Putative peptide transport system permease protein BruAb2_1031 Brucella abortus biovar 1 (strain 9-941)
Q8YDG7 7.12e-58 192 36 3 314 3 BMEII0209 Putative peptide transport system permease protein BMEII0209 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FUX0 8.21e-58 192 36 3 314 3 BRA1092 Putative peptide transport system permease protein BRA1092/BS1330_II1084 Brucella suis biovar 1 (strain 1330)
P94311 1.41e-55 187 32 1 319 3 dppB Dipeptide transport system permease protein DppB Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
P0AGH3 8.23e-48 167 36 4 267 1 sapB Putrescine export system permease protein SapB Escherichia coli (strain K12)
P0AGH4 8.23e-48 167 36 4 267 3 sapB Peptide transport system permease protein SapB Escherichia coli O157:H7
P33591 6.51e-45 159 30 2 336 1 nikB Nickel transport system permease protein NikB Escherichia coli (strain K12)
P42062 4.5e-44 157 29 4 321 3 appB Oligopeptide transport system permease protein AppB Bacillus subtilis (strain 168)
Q53191 2.69e-43 155 32 4 314 3 NGR_a01430 Probable peptide ABC transporter permease protein y4tP Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0A2J3 3.48e-43 154 37 4 267 2 sapB Peptide transport system permease protein SapB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J4 3.48e-43 154 37 4 267 3 sapB Peptide transport system permease protein SapB Salmonella typhi
Q8FJK9 4.78e-41 149 29 2 333 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q32IB7 1.34e-40 147 28 2 333 3 gsiC Glutathione transport system permease protein GsiC Shigella dysenteriae serotype 1 (strain Sd197)
Q1RE94 1.34e-40 147 28 2 333 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli (strain UTI89 / UPEC)
P75798 1.34e-40 147 28 2 333 1 gsiC Glutathione transport system permease protein GsiC Escherichia coli (strain K12)
Q0TJL7 1.34e-40 147 28 2 333 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A970 1.34e-40 147 28 2 333 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O1:K1 / APEC
Q8X6V7 3.02e-40 146 28 2 333 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O157:H7
Q0T6D1 3.19e-40 146 28 2 333 3 gsiC Glutathione transport system permease protein GsiC Shigella flexneri serotype 5b (strain 8401)
Q3Z3V2 3.29e-40 146 28 2 333 3 gsiC Glutathione transport system permease protein GsiC Shigella sonnei (strain Ss046)
Q83S26 4.61e-40 146 29 2 320 3 gsiC Glutathione transport system permease protein GsiC Shigella flexneri
Q8Z862 2.73e-39 144 28 2 333 3 gsiC Glutathione transport system permease protein GsiC Salmonella typhi
Q57RB0 2.73e-39 144 28 2 333 3 gsiC Glutathione transport system permease protein GsiC Salmonella choleraesuis (strain SC-B67)
Q323W3 2.78e-39 144 28 2 333 3 gsiC Glutathione transport system permease protein GsiC Shigella boydii serotype 4 (strain Sb227)
Q8ZQM2 4.19e-39 144 28 2 333 3 gsiC Glutathione transport system permease protein GsiC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8FWN8 5.14e-38 141 29 3 322 3 BRA0408 Putative peptide permease protein BRA0408/BS1330_II0405 Brucella suis biovar 1 (strain 1330)
Q5PGP5 6.3e-38 140 28 2 333 3 gsiC Glutathione transport system permease protein GsiC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q6D3B1 9.89e-38 140 30 2 320 3 gsiC Glutathione transport system permease protein GsiC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8YBN9 1.88e-37 139 29 3 322 3 BMEII0860 Putative peptide permease protein BMEII0860 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A5VU90 1.88e-37 139 29 3 322 3 BOV_A0351 Putative peptide permease protein BOV_A0351 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P45286 8.07e-37 138 29 5 282 3 sapB Peptide transport system permease protein SapB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A2RI75 5.91e-33 127 30 4 290 1 dppB Dipeptide transport system permease protein DppB Lactococcus lactis subsp. cremoris (strain MG1363)
P08005 3.04e-31 122 25 6 340 1 oppB Oligopeptide transport system permease protein OppB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A4N8 2.6e-30 120 25 2 332 3 oppB Oligopeptide transport system permease protein OppB Lactococcus lactis subsp. cremoris (strain SK11)
P0A4N7 2.6e-30 120 25 2 332 1 oppB Oligopeptide transport system permease protein OppB Lactococcus lactis subsp. lactis (strain IL1403)
P0AFH5 4.02e-29 117 24 6 340 3 oppB Oligopeptide transport system permease protein OppB Shigella flexneri
P0AFH2 4.02e-29 117 24 6 340 1 oppB Oligopeptide transport system permease protein OppB Escherichia coli (strain K12)
P0AFH3 4.02e-29 117 24 6 340 3 oppB Oligopeptide transport system permease protein OppB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFH4 4.02e-29 117 24 6 340 3 oppB Oligopeptide transport system permease protein OppB Escherichia coli O157:H7
P45054 1.78e-27 112 24 3 290 3 oppB Oligopeptide transport system permease protein OppB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P26903 1.31e-26 110 25 7 341 2 dppB Dipeptide transport system permease protein DppB Bacillus subtilis (strain 168)
Q7A5Q6 2.38e-26 110 25 3 316 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain N315)
Q99UA0 2.38e-26 110 25 3 316 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YXY7 2.38e-26 110 25 3 316 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8NWT4 3.07e-26 109 25 3 316 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MW2)
Q6G9H8 3.07e-26 109 25 3 316 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MSSA476)
Q5HG38 3.2e-26 109 25 3 316 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain COL)
Q2FYQ5 3.2e-26 109 25 3 316 1 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH55 3.2e-26 109 25 3 316 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain USA300)
Q6GH25 4.08e-26 109 24 3 329 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MRSA252)
A9CKL3 3.35e-22 99 25 4 291 3 yejB Peptidoglycan transport system permease protein YejB Agrobacterium fabrum (strain C58 / ATCC 33970)
P24138 3.57e-22 98 25 3 290 1 oppB Oligopeptide transport system permease protein OppB Bacillus subtilis (strain 168)
P66967 4e-22 98 28 10 319 3 BQ2027_MB1314C Putative peptide transport permease protein Mb1314c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFZ7 4e-22 98 28 10 319 1 Rv1283c Putative peptide transport permease protein Rv1283c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFZ6 4e-22 98 28 10 319 3 MT1320 Putative peptide transport permease protein MT1320 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0AFU0 1.11e-19 92 26 5 293 1 yejB Inner membrane ABC transporter permease protein YejB Escherichia coli (strain K12)
P0AFU1 1.11e-19 92 26 5 293 3 yejB Inner membrane ABC transporter permease protein YejB Escherichia coli O157:H7
P75554 5.45e-19 90 25 5 295 3 oppB Oligopeptide transport system permease protein OppB Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q2FVE8 1.36e-17 85 22 6 295 1 cntB Metal-staphylopine import system permease protein CntB Staphylococcus aureus (strain NCTC 8325 / PS 47)
A0A0H3K104 1.44e-17 85 22 6 295 1 cntB Metal-staphylopine import system permease protein CntB Staphylococcus aureus (strain Mu50 / ATCC 700699)
P47323 3.31e-15 79 25 6 285 3 oppB Oligopeptide transport system permease protein OppB Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P0A4M8 4.38e-12 70 29 0 131 3 amiC Oligopeptide transport system permease protein AmiC Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4M7 4.38e-12 70 29 0 131 3 amiC Oligopeptide transport system permease protein AmiC Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P0A4P0 1.17e-06 53 30 0 65 3 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. cremoris (strain SK11)
P0A4N9 1.47e-06 52 30 0 65 1 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. lactis (strain IL1403)
A0A0H2ZFV0 2.51e-05 48 37 3 87 1 dppC Di/tripeptide transport system permease protein DppC Pseudomonas aeruginosa (strain UCBPP-PA14)
P0AEG1 7.88e-05 47 37 0 61 1 dppC Dipeptide transport system permease protein DppC Escherichia coli (strain K12)
P0AEG2 7.88e-05 47 37 0 61 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEG3 7.88e-05 47 37 0 61 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O157:H7
P42063 8.42e-05 47 34 2 85 3 appC Oligopeptide transport system permease protein AppC Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_05310
Feature type CDS
Gene dppB
Product ABC-type dipeptide/oligopeptide/nickel transport system, permease component
Location 69450 - 70496 (strand: 1)
Length 1047 (nucleotides) / 348 (amino acids)
In genomic island -

Contig

Accession contig_5
Length 181448 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1032
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component
PF19300 Binding-prot-dependent transport system membrane comp, N-term

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0601 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)
EP ABC-type dipeptide/oligopeptide/nickel transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02033 peptide/nickel transport system permease protein Quorum sensing -

Protein Sequence

MSDISPAGTLFRHTLRVTLQGIFTLALTLLGLLVITFALSALSPVDRVLQIVGDHASHETYEQVRLELGLDQPVYIQFWHYAERLLHGDLGMASSMGQPVLDGVLTTLPATIELATLSLLIGASLGILCGVLCARYAGTPFDFIIRTLTLLGNSVPVFWLGLLMLLLFYATLQWSPGPGRLDDIYQYTVEAKTGFVLIDTWLADDPGAFTNAVAHLILPVSLLAYFCLAGITRLTRAACLSEMNKEYVTLARAKGNTDMQVLFRHVLPNIRGTLITVIALAYTGMLEGAVLTETVFSWPGIGRYLTAALFAGDTTAVMGGTLVIGICFIFINNVTDMIVRLTDPRVKS

Flanking regions ( +/- flanking 50bp)

AGTATCGCTGACGGGGTTTGTGTGTTTTGTTTTTATTCAGGAACTGCTGTATGTCCGATATTTCCCCTGCCGGAACACTGTTTCGCCATACGCTGCGTGTGACGCTTCAGGGTATTTTTACCCTTGCGCTGACACTGCTCGGATTACTGGTGATCACCTTTGCATTGTCGGCACTCTCACCGGTTGACCGGGTATTACAGATTGTCGGCGATCACGCCAGCCATGAGACCTATGAGCAGGTACGGCTGGAGCTGGGGCTCGATCAACCCGTCTATATTCAGTTCTGGCATTATGCAGAGCGTCTGCTGCACGGCGATCTCGGCATGGCCTCCTCTATGGGACAGCCGGTGCTCGACGGCGTGCTGACCACCCTGCCCGCGACCATTGAACTGGCGACGCTCTCACTGTTGATCGGCGCTTCGCTCGGCATTCTCTGCGGCGTGTTATGCGCCCGTTATGCCGGAACACCATTTGATTTTATCATCCGCACCCTGACACTCCTCGGCAACTCAGTACCGGTTTTCTGGCTGGGACTGCTGATGCTGCTGCTGTTTTATGCCACGCTGCAGTGGAGCCCCGGCCCGGGGCGGCTGGATGATATCTACCAGTATACCGTCGAGGCGAAAACCGGTTTTGTGCTGATCGACACCTGGTTGGCAGATGACCCCGGCGCATTTACCAATGCGGTCGCACACCTGATCCTGCCGGTGTCGCTGCTGGCCTATTTTTGCCTGGCGGGGATCACCCGGCTGACGCGCGCCGCCTGTCTGAGCGAAATGAATAAAGAGTATGTCACGCTGGCACGCGCCAAAGGCAATACCGACATGCAGGTGCTGTTCCGCCATGTGCTGCCGAATATCCGGGGGACGCTGATCACCGTGATTGCCCTTGCCTACACCGGAATGCTGGAAGGTGCGGTACTGACCGAAACGGTCTTTTCCTGGCCCGGCATCGGCCGTTACCTGACCGCCGCCCTGTTTGCCGGAGATACCACCGCCGTGATGGGCGGGACCCTGGTGATCGGTATCTGCTTTATCTTTATTAATAACGTGACCGATATGATTGTGCGTTTAACGGATCCGCGGGTGAAATCATGACATTACTGCCGAAAATCCGCCGTTCCCCGTCCGCGCTGACGGGCACCCTG