Homologs in group_952

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_12395 EHELCC_12395 100.0 Morganella morganii S2 - UPF0259 membrane protein CRX48_06510
NLDBIP_12735 NLDBIP_12735 100.0 Morganella morganii S4 - UPF0259 membrane protein CRX48_06510
LHKJJB_12595 LHKJJB_12595 100.0 Morganella morganii S3 - UPF0259 membrane protein CRX48_06510
HKOGLL_11210 HKOGLL_11210 100.0 Morganella morganii S5 - UPF0259 membrane protein CRX48_06510
F4V73_RS05650 F4V73_RS05650 81.4 Morganella psychrotolerans - YciC family protein
PMI_RS06520 PMI_RS06520 29.2 Proteus mirabilis HI4320 - YciC family protein

Distribution of the homologs in the orthogroup group_952

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_952

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8GF86 1.3e-49 166 40 1 247 3 Spro_2675 UPF0259 membrane protein Spro_2675 Serratia proteamaculans (strain 568)
Q7N475 2.4e-45 155 40 1 255 3 plu2479 UPF0259 membrane protein plu2479 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JQ02 5.08e-43 149 39 0 245 3 YE2218 UPF0259 membrane protein YE2218 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6D4T5 1.5e-40 143 38 1 248 3 ECA2305 UPF0259 membrane protein ECA2305 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A9MPE1 2.7e-38 137 34 1 250 3 yciC UPF0259 membrane protein YciC Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8ZP49 3.27e-38 137 34 1 250 3 yciC UPF0259 membrane protein YciC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BIB3 3.27e-38 137 34 1 250 3 yciC UPF0259 membrane protein YciC Salmonella paratyphi A (strain AKU_12601)
A9MWQ5 3.27e-38 137 34 1 250 3 yciC UPF0259 membrane protein YciC Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PD19 3.27e-38 137 34 1 250 3 yciC UPF0259 membrane protein YciC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUC3 3.27e-38 137 34 1 250 3 yciC UPF0259 membrane protein YciC Salmonella newport (strain SL254)
B4TJL6 3.27e-38 137 34 1 250 3 yciC UPF0259 membrane protein YciC Salmonella heidelberg (strain SL476)
B5R6L7 3.27e-38 137 34 1 250 3 yciC UPF0259 membrane protein YciC Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3N6 3.27e-38 137 34 1 250 3 yciC UPF0259 membrane protein YciC Salmonella enteritidis PT4 (strain P125109)
B5FU58 3.27e-38 137 34 1 250 3 yciC UPF0259 membrane protein YciC Salmonella dublin (strain CT_02021853)
Q57NS5 3.27e-38 137 34 1 250 3 yciC UPF0259 membrane protein YciC Salmonella choleraesuis (strain SC-B67)
B5F4L6 3.27e-38 137 34 1 250 3 yciC UPF0259 membrane protein YciC Salmonella agona (strain SL483)
Q8XCB7 3.52e-38 137 34 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O157:H7
C0Q399 3.84e-38 137 34 1 250 3 yciC UPF0259 membrane protein YciC Salmonella paratyphi C (strain RKS4594)
B4TX47 6.07e-38 136 34 1 250 3 yciC UPF0259 membrane protein YciC Salmonella schwarzengrund (strain CVM19633)
Q8FHW3 7.29e-38 136 34 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7ZL36 9.02e-38 135 34 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O139:H28 (strain E24377A / ETEC)
P21365 9.62e-38 135 34 1 250 1 yciC UPF0259 membrane protein YciC Escherichia coli (strain K12)
B1XBK4 9.62e-38 135 34 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli (strain K12 / DH10B)
C4ZTU8 9.62e-38 135 34 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli (strain K12 / MC4100 / BW2952)
B7UQE6 1.06e-37 135 34 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q83LC9 1.07e-37 135 33 1 250 3 yciC UPF0259 membrane protein YciC Shigella flexneri
Q0T5E1 1.07e-37 135 33 1 250 3 yciC UPF0259 membrane protein YciC Shigella flexneri serotype 5b (strain 8401)
Q31ZU9 1.07e-37 135 33 1 250 3 yciC UPF0259 membrane protein YciC Shigella boydii serotype 4 (strain Sb227)
Q8Z7E3 1.28e-37 135 34 1 250 3 yciC UPF0259 membrane protein YciC Salmonella typhi
Q1RCH9 1.38e-37 135 34 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli (strain UTI89 / UPEC)
B7N468 1.38e-37 135 34 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q0TIB5 1.38e-37 135 34 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AAI0 1.38e-37 135 34 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O1:K1 / APEC
B7MU43 1.38e-37 135 34 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O81 (strain ED1a)
B7NVM5 1.38e-37 135 34 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7ML08 1.38e-37 135 34 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O45:K1 (strain S88 / ExPEC)
C6DGZ0 1.42e-37 135 37 1 248 3 PC1_1998 UPF0259 membrane protein PC1_1998 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q3Z0Y3 1.68e-37 135 33 1 250 3 yciC UPF0259 membrane protein YciC Shigella sonnei (strain Ss046)
B6I9W9 1.68e-37 135 33 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli (strain SE11)
B1ITK0 1.68e-37 135 33 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZJ1 1.68e-37 135 33 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O9:H4 (strain HS)
B7LY11 1.68e-37 135 33 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O8 (strain IAI1)
B7LHK1 1.68e-37 135 33 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli (strain 55989 / EAEC)
B1LH37 2.05e-37 135 33 1 250 3 yciC UPF0259 membrane protein YciC Escherichia coli (strain SMS-3-5 / SECEC)
Q32GT9 1.18e-36 133 33 1 250 3 yciC UPF0259 membrane protein YciC Shigella dysenteriae serotype 1 (strain Sd197)
A8AG56 1.44e-35 130 34 1 250 3 CKO_01332 UPF0259 membrane protein CKO_01332 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4TJ73 6.46e-35 128 37 0 240 3 YPDSF_0935 UPF0259 membrane protein YPDSF_0935 Yersinia pestis (strain Pestoides F)
A9R9A1 6.46e-35 128 37 0 240 3 YpAngola_A2324 UPF0259 membrane protein YpAngola_A2324 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZEH4 6.46e-35 128 37 0 240 3 YPO2199 UPF0259 membrane protein YPO2199/y2042/YP_1997 Yersinia pestis
B2K3V8 6.46e-35 128 37 0 240 3 YPTS_2193 UPF0259 membrane protein YPTS_2193 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q66AK9 6.46e-35 128 37 0 240 3 YPTB2121 UPF0259 membrane protein YPTB2121 Yersinia pseudotuberculosis serotype I (strain IP32953)
B1JKS6 6.46e-35 128 37 0 240 3 YPK_2050 UPF0259 membrane protein YPK_2050 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FI39 6.46e-35 128 37 0 240 3 YpsIP31758_1942 UPF0259 membrane protein YpsIP31758_1942 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1CJ34 6.46e-35 128 37 0 240 3 YPN_1667 UPF0259 membrane protein YPN_1667 Yersinia pestis bv. Antiqua (strain Nepal516)
Q1C7P8 6.46e-35 128 37 0 240 3 YPA_1558 UPF0259 membrane protein YPA_1558 Yersinia pestis bv. Antiqua (strain Antiqua)
B7LS23 1.59e-33 124 31 2 250 3 yciC UPF0259 membrane protein YciC Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B5XT15 1.29e-32 122 34 1 247 3 KPK_3195 UPF0259 membrane protein KPK_3195 Klebsiella pneumoniae (strain 342)
A4WB73 6.2e-32 120 32 1 250 3 Ent638_2284 UPF0259 membrane protein Ent638_2284 Enterobacter sp. (strain 638)
A6T7V8 2.17e-31 119 34 1 247 3 KPN78578_12180 UPF0259 membrane protein KPN78578_12180 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MMH2 1.26e-27 109 34 1 250 3 ESA_01554 UPF0259 membrane protein ESA_01554 Cronobacter sakazakii (strain ATCC BAA-894)
P42396 2.58e-21 92 27 5 253 3 BUsg_265 UPF0259 membrane protein BUsg_265 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89AL2 9.21e-19 85 26 4 246 3 bbp_256 UPF0259 membrane protein bbp_256 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8D2I9 9.93e-17 80 30 7 253 3 WIGBR3650 UPF0259 membrane protein WIGBR3650 Wigglesworthia glossinidia brevipalpis
B8D969 1.75e-15 77 24 3 251 3 BUAP5A_271 UPF0259 membrane protein BUAP5A_271 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B8D7H3 1.93e-15 76 24 3 251 3 BUAPTUC7_273 UPF0259 membrane protein BUAPTUC7_273 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57364 3.07e-15 76 24 3 251 3 BU276 UPF0259 membrane protein BU276 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q2NT67 1.43e-11 66 34 2 200 3 SG1383 UPF0259 membrane protein SG1383 Sodalis glossinidius (strain morsitans)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_05195
Feature type CDS
Gene -
Product UPF0259 membrane protein CRX48_06510
Location 46541 - 47317 (strand: 1)
Length 777 (nucleotides) / 258 (amino acids)

Contig

Accession contig_5
Length 181448 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_952
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06790 Uncharacterised protein family (UPF0259)

Protein Sequence

MSMPVPVLARDSLNFFRNQLSSVLIISLLTAAVTVGLNVLLTYNSNGLALIRALETTYATEGSGGFQRAVAALTSDDQWQMLKTGLGTIFSSLLGNAVFVTSMIFLIFSASQGQPVSALQAITGSAGRIPRMLVLLLICSLVIALGLVAMYLPGLILAMLLALAPIIMFTEKNSVFTAIKISGNIALKNIRTLLPAILIWFALKQASVVFLSKLPIENEHILMTVILFINNVISGLVIIYLFRFYQLFTQSQSVSDYQ

Flanking regions ( +/- flanking 50bp)

TTTTACAATTGCATCAACGTTTTTATTTCATGCCTTACAGGAGTTGTTCCATGTCCATGCCGGTGCCGGTTCTTGCCCGCGACAGTCTTAATTTTTTCCGTAATCAGCTGTCGTCTGTCCTGATCATTTCGCTGCTCACCGCCGCTGTGACCGTCGGGCTCAATGTCCTCCTGACTTACAATTCCAACGGGCTGGCACTTATCCGTGCTCTGGAGACCACTTACGCCACTGAAGGCTCCGGCGGCTTTCAGCGGGCGGTCGCCGCACTGACATCCGATGACCAGTGGCAGATGCTGAAAACCGGCCTCGGAACTATCTTCAGTTCCCTGCTGGGCAATGCCGTCTTTGTGACGTCCATGATTTTCCTGATTTTCAGTGCCTCACAGGGACAGCCGGTATCTGCGTTGCAGGCCATCACCGGCTCTGCCGGACGCATTCCGCGCATGCTGGTGCTGCTGTTAATCTGCTCGCTGGTGATTGCCCTCGGACTCGTTGCCATGTATCTGCCGGGATTAATTCTGGCTATGTTACTGGCGCTGGCACCGATCATTATGTTCACCGAAAAGAACAGCGTATTTACTGCTATTAAAATCAGCGGAAATATTGCCCTGAAAAATATCAGAACACTTCTGCCTGCTATTTTAATATGGTTTGCCCTGAAACAGGCATCCGTAGTGTTTCTTAGTAAACTACCGATAGAAAATGAGCATATTCTGATGACTGTTATTCTGTTTATTAATAATGTCATCAGCGGACTGGTAATTATTTATCTGTTCCGGTTCTATCAGTTATTTACACAATCGCAATCTGTCAGCGACTATCAGTAAGGCCGGATAATGCGCACAAAGGAAAGATATTTTGCGCCTGCTGTCACAGA