Homologs in group_1020

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05195 FBDBKF_05195 81.4 Morganella morganii S1 - UPF0259 membrane protein CRX48_06510
EHELCC_12395 EHELCC_12395 81.4 Morganella morganii S2 - UPF0259 membrane protein CRX48_06510
NLDBIP_12735 NLDBIP_12735 81.4 Morganella morganii S4 - UPF0259 membrane protein CRX48_06510
LHKJJB_12595 LHKJJB_12595 81.4 Morganella morganii S3 - UPF0259 membrane protein CRX48_06510
HKOGLL_11210 HKOGLL_11210 81.4 Morganella morganii S5 - UPF0259 membrane protein CRX48_06510
PMI_RS06520 PMI_RS06520 32.5 Proteus mirabilis HI4320 - YciC family protein

Distribution of the homologs in the orthogroup group_1020

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1020

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8GF86 1.55e-43 150 35 0 247 3 Spro_2675 UPF0259 membrane protein Spro_2675 Serratia proteamaculans (strain 568)
A1JQ02 5.22e-40 142 35 0 252 3 YE2218 UPF0259 membrane protein YE2218 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7N475 7.01e-40 141 34 0 252 3 plu2479 UPF0259 membrane protein plu2479 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8ZP49 4.16e-37 134 30 2 250 3 yciC UPF0259 membrane protein YciC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BIB3 4.16e-37 134 30 2 250 3 yciC UPF0259 membrane protein YciC Salmonella paratyphi A (strain AKU_12601)
A9MWQ5 4.16e-37 134 30 2 250 3 yciC UPF0259 membrane protein YciC Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PD19 4.16e-37 134 30 2 250 3 yciC UPF0259 membrane protein YciC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUC3 4.16e-37 134 30 2 250 3 yciC UPF0259 membrane protein YciC Salmonella newport (strain SL254)
B4TJL6 4.16e-37 134 30 2 250 3 yciC UPF0259 membrane protein YciC Salmonella heidelberg (strain SL476)
B5R6L7 4.16e-37 134 30 2 250 3 yciC UPF0259 membrane protein YciC Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3N6 4.16e-37 134 30 2 250 3 yciC UPF0259 membrane protein YciC Salmonella enteritidis PT4 (strain P125109)
B5FU58 4.16e-37 134 30 2 250 3 yciC UPF0259 membrane protein YciC Salmonella dublin (strain CT_02021853)
Q57NS5 4.16e-37 134 30 2 250 3 yciC UPF0259 membrane protein YciC Salmonella choleraesuis (strain SC-B67)
B5F4L6 4.16e-37 134 30 2 250 3 yciC UPF0259 membrane protein YciC Salmonella agona (strain SL483)
A9MPE1 5.2e-37 134 30 2 250 3 yciC UPF0259 membrane protein YciC Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
C0Q399 6.58e-37 133 30 2 250 3 yciC UPF0259 membrane protein YciC Salmonella paratyphi C (strain RKS4594)
Q8Z7E3 1.56e-36 132 30 2 250 3 yciC UPF0259 membrane protein YciC Salmonella typhi
B4TX47 3.06e-36 132 30 2 250 3 yciC UPF0259 membrane protein YciC Salmonella schwarzengrund (strain CVM19633)
A7ZL36 4.74e-35 129 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AG56 5.11e-35 129 30 2 250 3 CKO_01332 UPF0259 membrane protein CKO_01332 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q6D4T5 6.89e-35 128 34 0 248 3 ECA2305 UPF0259 membrane protein ECA2305 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8XCB7 7.11e-35 128 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O157:H7
Q83LC9 1.12e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Shigella flexneri
Q0T5E1 1.12e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Shigella flexneri serotype 5b (strain 8401)
Q31ZU9 1.12e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Shigella boydii serotype 4 (strain Sb227)
B7UQE6 1.19e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3Z0Y3 1.25e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Shigella sonnei (strain Ss046)
B6I9W9 1.25e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli (strain SE11)
B1ITK0 1.25e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZJ1 1.25e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O9:H4 (strain HS)
B7LY11 1.25e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O8 (strain IAI1)
B7LHK1 1.25e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli (strain 55989 / EAEC)
B1LH37 1.53e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli (strain SMS-3-5 / SECEC)
Q8FHW3 1.53e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P21365 2.02e-34 127 30 2 250 1 yciC UPF0259 membrane protein YciC Escherichia coli (strain K12)
B1XBK4 2.02e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli (strain K12 / DH10B)
C4ZTU8 2.02e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli (strain K12 / MC4100 / BW2952)
Q1RCH9 2.69e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli (strain UTI89 / UPEC)
B7N468 2.69e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q0TIB5 2.69e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AAI0 2.69e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O1:K1 / APEC
B7MU43 2.69e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O81 (strain ED1a)
B7NVM5 2.69e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7ML08 2.69e-34 127 30 2 250 3 yciC UPF0259 membrane protein YciC Escherichia coli O45:K1 (strain S88 / ExPEC)
A4TJ73 4.2e-34 126 35 0 247 3 YPDSF_0935 UPF0259 membrane protein YPDSF_0935 Yersinia pestis (strain Pestoides F)
A9R9A1 4.2e-34 126 35 0 247 3 YpAngola_A2324 UPF0259 membrane protein YpAngola_A2324 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZEH4 4.2e-34 126 35 0 247 3 YPO2199 UPF0259 membrane protein YPO2199/y2042/YP_1997 Yersinia pestis
B2K3V8 4.2e-34 126 35 0 247 3 YPTS_2193 UPF0259 membrane protein YPTS_2193 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q66AK9 4.2e-34 126 35 0 247 3 YPTB2121 UPF0259 membrane protein YPTB2121 Yersinia pseudotuberculosis serotype I (strain IP32953)
B1JKS6 4.2e-34 126 35 0 247 3 YPK_2050 UPF0259 membrane protein YPK_2050 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FI39 4.2e-34 126 35 0 247 3 YpsIP31758_1942 UPF0259 membrane protein YpsIP31758_1942 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1CJ34 4.2e-34 126 35 0 247 3 YPN_1667 UPF0259 membrane protein YPN_1667 Yersinia pestis bv. Antiqua (strain Nepal516)
Q1C7P8 4.2e-34 126 35 0 247 3 YPA_1558 UPF0259 membrane protein YPA_1558 Yersinia pestis bv. Antiqua (strain Antiqua)
Q32GT9 2.12e-33 124 29 2 250 3 yciC UPF0259 membrane protein YciC Shigella dysenteriae serotype 1 (strain Sd197)
C6DGZ0 1.03e-32 122 34 0 248 3 PC1_1998 UPF0259 membrane protein PC1_1998 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B7LS23 4.9e-31 118 28 1 250 3 yciC UPF0259 membrane protein YciC Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B5XT15 5.83e-29 112 31 2 247 3 KPK_3195 UPF0259 membrane protein KPK_3195 Klebsiella pneumoniae (strain 342)
A4WB73 4.55e-28 110 29 2 250 3 Ent638_2284 UPF0259 membrane protein Ent638_2284 Enterobacter sp. (strain 638)
A6T7V8 6.11e-28 110 31 2 247 3 KPN78578_12180 UPF0259 membrane protein KPN78578_12180 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MMH2 5.38e-25 102 30 2 250 3 ESA_01554 UPF0259 membrane protein ESA_01554 Cronobacter sakazakii (strain ATCC BAA-894)
P42396 4.78e-22 94 25 2 251 3 BUsg_265 UPF0259 membrane protein BUsg_265 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B8D969 5.97e-21 91 26 3 252 3 BUAP5A_271 UPF0259 membrane protein BUAP5A_271 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
P57364 6.15e-21 91 26 3 252 3 BU276 UPF0259 membrane protein BU276 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D7H3 7.33e-21 91 26 3 252 3 BUAPTUC7_273 UPF0259 membrane protein BUAPTUC7_273 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
Q8D2I9 1.23e-19 88 30 7 254 3 WIGBR3650 UPF0259 membrane protein WIGBR3650 Wigglesworthia glossinidia brevipalpis
Q89AL2 5.87e-19 86 23 1 247 3 bbp_256 UPF0259 membrane protein bbp_256 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q2NT67 2.83e-10 62 30 2 237 3 SG1383 UPF0259 membrane protein SG1383 Sodalis glossinidius (strain morsitans)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05650
Feature type CDS
Gene -
Product YciC family protein
Location 1201967 - 1202743 (strand: 1)
Length 777 (nucleotides) / 258 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1020
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06790 Uncharacterised protein family (UPF0259)

Protein Sequence

MSMSVSGLARDSLNFFRNQAASVLVISLLTAVIAVALNVLLTYNSNGTDIIRMLESTYINEGSGEFQRAVAALTADDQWQMLKTGLGSILGSLLGNAVFVTSIIFLVFSASQGETLTAVQAITGSAGRIPRMLVLLLICSLVIALGLVAMYLPGLVLAMLLALAPIVMFTEKNSIFTAIKISGNIAMKNIRTLLPAILIWFALKQVSVMLLSRLPLPNEHITMVIVLFLNNIISGLMIIYLFRFYQLFTQSQSINDYQ

Flanking regions ( +/- flanking 50bp)

TTTTAATTTATGTCTATACCCAACGTCATTCAGGATACAGGAGCCGTTTCATGTCCATGTCGGTGTCAGGCCTTGCCCGCGACAGTCTTAATTTTTTCCGCAATCAGGCTGCATCTGTTCTGGTTATTTCTCTGCTCACCGCCGTTATTGCCGTTGCTCTCAACGTCCTGCTGACTTATAACTCTAACGGAACGGATATCATCCGTATGTTGGAATCCACCTATATTAATGAGGGTTCCGGCGAATTTCAGCGCGCAGTCGCCGCACTGACTGCCGACGACCAGTGGCAGATGCTGAAAACCGGGCTGGGCAGTATTTTAGGCTCTCTGCTGGGTAATGCGGTTTTTGTGACATCCATAATTTTCCTGGTATTCAGCGCATCACAGGGCGAGACTCTGACAGCGGTTCAGGCAATCACCGGCTCTGCCGGACGTATACCGCGCATGTTAGTTCTGTTGCTTATCTGTTCGCTAGTGATAGCTCTCGGGTTGGTCGCCATGTATTTACCGGGTCTGGTGCTGGCGATGCTGCTGGCTCTCGCGCCTATCGTGATGTTCACCGAAAAAAACAGTATTTTCACCGCGATTAAAATCAGCGGTAATATTGCGATGAAAAATATCAGAACACTTCTGCCGGCTATTTTAATCTGGTTTGCACTGAAACAGGTATCCGTTATGTTACTCAGCCGGTTACCGCTGCCGAATGAACATATTACGATGGTCATCGTATTGTTCTTAAATAACATTATCAGCGGGCTGATGATTATTTATCTGTTCCGGTTTTATCAGTTATTTACGCAATCACAATCGATTAACGATTATCAGTAATTCGTTATTCCCCGCCCCGTCTGTCTGACGGGGTTTTCTTTTTTATTCCC