Homologs in group_953

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_05835 EHELCC_05835 100.0 Morganella morganii S2 sprT SprT family zinc-dependent metalloprotease
NLDBIP_06155 NLDBIP_06155 100.0 Morganella morganii S4 sprT SprT family zinc-dependent metalloprotease
LHKJJB_03035 LHKJJB_03035 100.0 Morganella morganii S3 sprT SprT family zinc-dependent metalloprotease
HKOGLL_06510 HKOGLL_06510 100.0 Morganella morganii S5 sprT SprT family zinc-dependent metalloprotease
F4V73_RS09000 F4V73_RS09000 83.2 Morganella psychrotolerans - SprT family zinc-dependent metalloprotease
PMI_RS10370 PMI_RS10370 62.3 Proteus mirabilis HI4320 - SprT family zinc-dependent metalloprotease

Distribution of the homologs in the orthogroup group_953

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_953

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZHG6 1.46e-70 213 67 1 149 3 sprT Protein SprT Yersinia pestis
A7FEZ6 1.63e-70 213 67 1 149 3 sprT Protein SprT Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7N118 5.36e-70 213 64 1 150 3 sprT Protein SprT Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4F1B5 1.17e-69 211 63 0 149 3 sprT Protein SprT Proteus mirabilis (strain HI4320)
Q666P4 1.8e-69 211 67 1 149 3 sprT Protein SprT Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K0S8 1.8e-69 211 67 1 149 3 sprT Protein SprT Yersinia pseudotuberculosis serotype IB (strain PB1/+)
C6DFI4 6.72e-68 206 64 1 156 3 sprT Protein SprT Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A7MJR0 8.74e-68 206 64 1 153 3 sprT Protein SprT Cronobacter sakazakii (strain ATCC BAA-894)
Q6D080 1.04e-67 206 64 1 156 3 sprT Protein SprT Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JPT0 1.4e-67 206 65 1 151 3 sprT Protein SprT Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VF08 6.06e-67 204 64 1 149 3 sprT Protein SprT Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q3YXS7 4.45e-66 202 63 1 150 3 sprT Protein SprT Shigella sonnei (strain Ss046)
Q1R783 4.54e-66 202 63 1 150 3 sprT Protein SprT Escherichia coli (strain UTI89 / UPEC)
B6I782 4.54e-66 202 63 1 150 3 sprT Protein SprT Escherichia coli (strain SE11)
B7N7J7 4.54e-66 202 63 1 150 3 sprT Protein SprT Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FE31 4.54e-66 202 63 1 150 3 sprT Protein SprT Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AFD0 4.54e-66 202 63 1 150 3 sprT Protein SprT Escherichia coli O1:K1 / APEC
B7MZP3 4.54e-66 202 63 1 150 3 sprT Protein SprT Escherichia coli O81 (strain ED1a)
B7NI07 4.54e-66 202 63 1 150 3 sprT Protein SprT Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7LFK7 4.54e-66 202 63 1 150 3 sprT Protein SprT Escherichia coli (strain 55989 / EAEC)
B7MMD2 4.54e-66 202 63 1 150 3 sprT Protein SprT Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UHZ1 4.54e-66 202 63 1 150 3 sprT Protein SprT Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q83JS6 5.35e-66 201 63 1 150 3 sprT Protein SprT Shigella flexneri
Q0T0U8 5.35e-66 201 63 1 150 3 sprT Protein SprT Shigella flexneri serotype 5b (strain 8401)
Q31WK6 6.04e-66 201 63 1 150 3 sprT Protein SprT Shigella boydii serotype 4 (strain Sb227)
P39902 6.04e-66 201 63 1 150 3 sprT Protein SprT Escherichia coli (strain K12)
A8A484 6.04e-66 201 63 1 150 3 sprT Protein SprT Escherichia coli O9:H4 (strain HS)
B1XFA5 6.04e-66 201 63 1 150 3 sprT Protein SprT Escherichia coli (strain K12 / DH10B)
C5A0L3 6.04e-66 201 63 1 150 3 sprT Protein SprT Escherichia coli (strain K12 / MC4100 / BW2952)
Q32C13 6.31e-66 201 63 1 150 3 sprT Protein SprT Shigella dysenteriae serotype 1 (strain Sd197)
B1LDF3 6.81e-66 201 62 1 150 3 sprT Protein SprT Escherichia coli (strain SMS-3-5 / SECEC)
B2U0W4 2.03e-65 200 62 1 150 3 sprT Protein SprT Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q8XCW6 2.95e-65 200 62 1 150 3 sprT Protein SprT Escherichia coli O157:H7
B7LYX4 2.98e-65 199 62 1 150 3 sprT Protein SprT Escherichia coli O8 (strain IAI1)
A7ZR67 2.98e-65 199 62 1 150 3 sprT Protein SprT Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LPR1 4.08e-64 197 62 1 149 3 sprT Protein SprT Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4WE80 8.67e-64 196 62 1 150 3 sprT Protein SprT Enterobacter sp. (strain 638)
B5XUA6 2.42e-63 195 63 1 150 3 sprT Protein SprT Klebsiella pneumoniae (strain 342)
A9MRC8 8.17e-63 193 62 1 150 3 sprT Protein SprT Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6TDV3 1e-62 193 63 1 150 3 sprT Protein SprT Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A8GJ28 6.87e-62 191 59 1 149 3 sprT Protein SprT Serratia proteamaculans (strain 568)
P60190 1.58e-61 190 62 1 150 3 sprT Protein SprT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P60189 1.58e-61 190 62 1 150 3 sprT Protein SprT Salmonella typhi
B4TV61 1.58e-61 190 62 1 150 3 sprT Protein SprT Salmonella schwarzengrund (strain CVM19633)
B4T5J9 1.58e-61 190 62 1 150 3 sprT Protein SprT Salmonella newport (strain SL254)
B4THH7 1.58e-61 190 62 1 150 3 sprT Protein SprT Salmonella heidelberg (strain SL476)
B5RE52 1.58e-61 190 62 1 150 3 sprT Protein SprT Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QY68 1.58e-61 190 62 1 150 3 sprT Protein SprT Salmonella enteritidis PT4 (strain P125109)
B5FUV5 1.58e-61 190 62 1 150 3 sprT Protein SprT Salmonella dublin (strain CT_02021853)
B5F5L7 1.58e-61 190 62 1 150 3 sprT Protein SprT Salmonella agona (strain SL483)
B5BFP9 7.73e-61 188 62 1 150 3 sprT Protein SprT Salmonella paratyphi A (strain AKU_12601)
Q5PJJ0 7.73e-61 188 62 1 150 3 sprT Protein SprT Salmonella paratyphi A (strain ATCC 9150 / SARB42)
C0PY69 1.43e-60 188 62 1 150 3 sprT Protein SprT Salmonella paratyphi C (strain RKS4594)
Q57K24 2.72e-60 187 62 1 150 3 sprT Protein SprT Salmonella choleraesuis (strain SC-B67)
A5F9H3 2.29e-53 169 51 1 151 3 sprT Protein SprT Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B8F6H5 1.09e-51 165 53 2 149 3 sprT Protein SprT Glaesserella parasuis serovar 5 (strain SH0165)
C3LRY8 2.54e-50 162 50 1 151 3 sprT Protein SprT Vibrio cholerae serotype O1 (strain M66-2)
Q9KUP4 2.54e-50 162 50 1 151 3 sprT Protein SprT Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8DCA5 2.8e-50 162 51 1 142 3 sprT Protein SprT Vibrio vulnificus (strain CMCP6)
Q7MHK4 2.83e-50 162 51 1 142 3 sprT Protein SprT Vibrio vulnificus (strain YJ016)
P44119 6.85e-50 160 51 1 137 3 sprT Protein SprT Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A7MTP2 1.76e-49 160 48 1 153 3 sprT Protein SprT Vibrio campbellii (strain ATCC BAA-1116)
Q7VMU2 7.18e-49 158 46 1 153 3 sprT Protein SprT Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q87LK4 3.28e-48 156 47 1 148 3 sprT Protein SprT Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VKP6 5.12e-48 156 48 1 150 3 sprT Protein SprT Vibrio atlanticus (strain LGP32)
A6VML0 1.67e-44 147 49 1 142 3 sprT Protein SprT Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q9CM18 8.48e-44 145 50 1 134 3 sprT Protein SprT Pasteurella multocida (strain Pm70)
Q8EIK5 2.56e-41 139 43 1 149 3 sprT Protein SprT Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A6V910 1.47e-28 106 38 3 144 3 sprT Protein SprT Pseudomonas aeruginosa (strain PA7)
Q02J09 5.29e-27 102 38 3 141 3 sprT Protein SprT Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9I4E9 1.73e-26 101 37 3 141 3 sprT Protein SprT Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7UX01 1.73e-26 101 37 3 141 3 sprT Protein SprT Pseudomonas aeruginosa (strain LESB58)
C3JY45 3.16e-26 100 36 3 150 3 sprT Protein SprT Pseudomonas fluorescens (strain SBW25)
Q4K880 7.8e-26 99 35 3 153 3 sprT Protein SprT Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B1J1K1 1.79e-25 98 37 3 143 3 sprT Protein SprT Pseudomonas putida (strain W619)
Q48FG7 3.13e-25 98 36 3 143 3 sprT Protein SprT Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZQ34 4.62e-25 97 36 3 143 3 sprT Protein SprT Pseudomonas syringae pv. syringae (strain B728a)
Q88MD4 4.92e-25 97 36 3 143 3 sprT Protein SprT Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W7U2 5.54e-25 97 36 3 143 3 sprT Protein SprT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IDN4 1.81e-24 96 35 3 143 3 sprT Protein SprT Pseudomonas entomophila (strain L48)
Q3K8D3 3.04e-24 95 34 3 153 3 sprT Protein SprT Pseudomonas fluorescens (strain Pf0-1)
Q885Z8 6.24e-24 94 35 3 143 3 sprT Protein SprT Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B0KT30 2.22e-23 93 34 3 143 3 sprT Protein SprT Pseudomonas putida (strain GB-1)
Q8P1Y0 1.68e-05 45 27 5 126 3 spyM18_0649 Protein SprT-like Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XD73 4.94e-05 44 26 5 126 3 M6_Spy0505 Protein SprT-like Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DF75 0.000616 41 26 5 126 3 SPs1445 Protein SprT-like Streptococcus pyogenes serotype M3 (strain SSI-1)
Q1J7Q8 0.000616 41 26 5 126 3 MGAS10750_Spy0503 Protein SprT-like Streptococcus pyogenes serotype M4 (strain MGAS10750)
P0DF74 0.000616 41 26 5 126 3 SpyM3_0410 Protein SprT-like Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q9A0W7 0.000641 41 26 5 126 3 SPy_0581 Protein SprT-like Streptococcus pyogenes serotype M1

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_04545
Feature type CDS
Gene sprT
Product SprT family zinc-dependent metalloprotease
Location 104501 - 105010 (strand: 1)
Length 510 (nucleotides) / 169 (amino acids)
In genomic island -

Contig

Accession contig_4
Length 199551 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_953
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF10263 SprT-like family
PF17283 SprT-like zinc ribbon domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3091 General function prediction only (R) R Predicted Zn-dependent metalloprotease, SprT family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02742 SprT protein - -

Protein Sequence

MQTLRDYLARACRVLKTDYPEPELNYRQRGTTAGSACLQTWEIRLNPVLLTENGPGFIQDVVPHELAHLLVYRRFGRVAPHGREWQWMMTEVLGVPAVRTHRFDVTSVRARTFTYRCQCKTAHELTVRRHNKVLRGESQYLCRHCKSTLVWDNSAAAISSPCDLTPDQS

Flanking regions ( +/- flanking 50bp)

TTCCGGCTATGAAACCGACCCGAGTCCCCACCGCATTACAGCAGGCCTGCATGCAGACCCTGCGTGATTATCTGGCCCGCGCCTGCCGGGTGCTGAAGACGGATTATCCGGAGCCTGAACTGAACTATCGTCAGCGCGGCACCACCGCCGGCAGTGCCTGCCTGCAAACATGGGAAATCCGCCTCAATCCGGTGTTACTGACGGAAAACGGCCCCGGATTTATACAGGATGTGGTTCCTCACGAGCTGGCGCATCTGCTGGTTTACCGCCGTTTCGGACGCGTGGCGCCTCACGGGCGGGAATGGCAGTGGATGATGACAGAGGTGCTGGGTGTTCCGGCCGTCCGTACACACCGCTTTGATGTGACGTCTGTCCGCGCCCGGACATTCACTTACCGCTGCCAATGCAAAACGGCACATGAACTGACTGTCCGCCGCCATAACAAAGTGTTGCGCGGGGAAAGTCAGTACCTGTGCCGTCACTGTAAAAGTACGCTGGTGTGGGATAACAGTGCAGCTGCAATATCATCCCCGTGCGACCTTACACCAGATCAGTCATAATCAGTTTGGCCATCTCGAAGTAGATAATCAGCCCGGTGCCGTCAATCAGT