Homologs in group_800

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_06775 EHELCC_06775 100.0 Morganella morganii S2 efp elongation factor P
NLDBIP_07100 NLDBIP_07100 100.0 Morganella morganii S4 efp elongation factor P
LHKJJB_06635 LHKJJB_06635 100.0 Morganella morganii S3 efp elongation factor P
HKOGLL_04295 HKOGLL_04295 100.0 Morganella morganii S5 efp elongation factor P
F4V73_RS11115 F4V73_RS11115 93.6 Morganella psychrotolerans efp elongation factor P
PMI_RS12510 PMI_RS12510 92.0 Proteus mirabilis HI4320 efp elongation factor P

Distribution of the homologs in the orthogroup group_800

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_800

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EXC9 3.86e-129 363 92 0 188 3 efp Elongation factor P Proteus mirabilis (strain HI4320)
Q7MZX9 6.32e-129 362 90 0 188 3 efp Elongation factor P Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2NW91 8.1e-124 349 86 0 188 3 efp Elongation factor P Sodalis glossinidius (strain morsitans)
A7MMC3 4.96e-122 345 86 0 188 3 efp Elongation factor P Cronobacter sakazakii (strain ATCC BAA-894)
A6TH65 9.89e-122 344 87 0 188 3 efp Elongation factor P Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y354 9.89e-122 344 87 0 188 3 efp Elongation factor P Klebsiella pneumoniae (strain 342)
C4K7E2 4.45e-121 342 84 0 188 3 efp Elongation factor P Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
P64036 4.8e-121 342 86 0 188 1 efp Elongation factor P Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P64037 4.8e-121 342 86 0 188 3 efp Elongation factor P Salmonella typhi
B4TSD0 4.8e-121 342 86 0 188 3 efp Elongation factor P Salmonella schwarzengrund (strain CVM19633)
B5BKF8 4.8e-121 342 86 0 188 3 efp Elongation factor P Salmonella paratyphi A (strain AKU_12601)
C0Q6A6 4.8e-121 342 86 0 188 3 efp Elongation factor P Salmonella paratyphi C (strain RKS4594)
Q5PL77 4.8e-121 342 86 0 188 3 efp Elongation factor P Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T2P5 4.8e-121 342 86 0 188 3 efp Elongation factor P Salmonella newport (strain SL254)
B4TF84 4.8e-121 342 86 0 188 3 efp Elongation factor P Salmonella heidelberg (strain SL476)
B5R995 4.8e-121 342 86 0 188 3 efp Elongation factor P Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R009 4.8e-121 342 86 0 188 3 efp Elongation factor P Salmonella enteritidis PT4 (strain P125109)
B5FRK6 4.8e-121 342 86 0 188 3 efp Elongation factor P Salmonella dublin (strain CT_02021853)
A9MFR5 4.8e-121 342 86 0 188 3 efp Elongation factor P Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F2L4 4.8e-121 342 86 0 188 3 efp Elongation factor P Salmonella agona (strain SL483)
Q3YUJ2 9.58e-121 342 86 0 188 3 efp Elongation factor P Shigella sonnei (strain Ss046)
P0A6N7 9.58e-121 342 86 0 188 3 efp Elongation factor P Shigella flexneri
Q0SXD0 9.58e-121 342 86 0 188 3 efp Elongation factor P Shigella flexneri serotype 5b (strain 8401)
Q328H8 9.58e-121 342 86 0 188 3 efp Elongation factor P Shigella dysenteriae serotype 1 (strain Sd197)
Q31T82 9.58e-121 342 86 0 188 3 efp Elongation factor P Shigella boydii serotype 4 (strain Sb227)
B2TY23 9.58e-121 342 86 0 188 3 efp Elongation factor P Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LLS9 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R3B2 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli (strain UTI89 / UPEC)
B1LQG8 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli (strain SMS-3-5 / SECEC)
B6I254 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli (strain SE11)
B7NG85 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6N4 9.58e-121 342 86 0 188 1 efp Elongation factor P Escherichia coli (strain K12)
B1ITQ1 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6N5 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T9P4 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AJ55 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli O1:K1 / APEC
A8A7P4 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli O9:H4 (strain HS)
B1XDQ0 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli (strain K12 / DH10B)
C5A1D9 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli (strain K12 / MC4100 / BW2952)
B7M8R0 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli O8 (strain IAI1)
B7MSG8 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli O81 (strain ED1a)
B7NTK6 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z2F6 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6N6 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli O157:H7
B7LC03 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli (strain 55989 / EAEC)
B7MKV2 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPW7 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZV18 9.58e-121 342 86 0 188 3 efp Elongation factor P Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AMQ1 8.41e-120 339 85 0 188 3 efp Elongation factor P Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4W5P1 1.56e-117 333 83 0 188 3 efp Elongation factor P Enterobacter sp. (strain 638)
A1JIP6 1.25e-116 331 82 0 188 3 efp Elongation factor P Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JMQ7 7.56e-116 329 81 0 188 3 efp Elongation factor P Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FD2 7.56e-116 329 81 0 188 3 efp Elongation factor P Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRQ7 7.56e-116 329 81 0 188 3 efp Elongation factor P Yersinia pestis (strain Pestoides F)
Q1CED7 7.56e-116 329 81 0 188 3 efp Elongation factor P Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYP8 7.56e-116 329 81 0 188 3 efp Elongation factor P Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIY0 7.56e-116 329 81 0 188 3 efp Elongation factor P Yersinia pestis
B2K1Y7 7.56e-116 329 81 0 188 3 efp Elongation factor P Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0Y3 7.56e-116 329 81 0 188 3 efp Elongation factor P Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMZ8 7.56e-116 329 81 0 188 3 efp Elongation factor P Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q3IFP5 9.22e-113 322 80 0 188 3 efp Elongation factor P Pseudoalteromonas translucida (strain TAC 125)
Q5QVT8 6.23e-111 317 78 0 188 3 efp Elongation factor P Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
C3LS89 7.49e-111 317 78 0 188 3 efp Elongation factor P Vibrio cholerae serotype O1 (strain M66-2)
Q9KNS1 7.49e-111 317 78 0 188 3 efp Elongation factor P Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4X8 7.49e-111 317 78 0 188 3 efp Elongation factor P Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C6DFP1 3.52e-110 315 77 0 188 3 efp Elongation factor P Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6LM11 6.36e-109 312 75 0 188 3 efp Elongation factor P Photobacterium profundum (strain SS9)
A8G8T0 8.64e-109 311 77 0 188 3 efp Elongation factor P Serratia proteamaculans (strain 568)
B2VL81 1.48e-108 311 77 0 188 3 efp Elongation factor P Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
P57811 1.78e-108 311 78 0 188 3 efp Elongation factor P Pasteurella multocida (strain Pm70)
A7MZ47 2.12e-108 310 75 0 188 3 efp Elongation factor P Vibrio campbellii (strain ATCC BAA-1116)
Q7MGX2 2.29e-108 310 75 0 188 3 efp Elongation factor P Vibrio vulnificus (strain YJ016)
Q8DCX6 2.29e-108 310 75 0 188 3 efp Elongation factor P Vibrio vulnificus (strain CMCP6)
Q87KX9 4.24e-108 310 75 0 188 3 efp Elongation factor P Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6D025 6.02e-108 309 76 0 188 3 efp Elongation factor P Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q65V95 7.38e-108 309 76 0 188 3 efp Elongation factor P Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0UWM5 8.36e-108 309 77 0 188 3 efp Elongation factor P Histophilus somni (strain 2336)
Q0I4U4 8.36e-108 309 77 0 188 3 efp Elongation factor P Histophilus somni (strain 129Pt)
P43771 1.24e-107 308 77 0 188 3 efp Elongation factor P Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UAF9 1.24e-107 308 77 0 188 3 efp Elongation factor P Haemophilus influenzae (strain PittEE)
Q4QNL2 1.24e-107 308 77 0 188 3 efp Elongation factor P Haemophilus influenzae (strain 86-028NP)
A5UGE0 1.88e-107 308 77 0 188 3 efp Elongation factor P Haemophilus influenzae (strain PittGG)
B3H1A1 2.12e-106 305 75 0 188 3 efp Elongation factor P Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N042 2.12e-106 305 75 0 188 3 efp Elongation factor P Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6VR54 9.43e-106 304 75 0 188 3 efp Elongation factor P Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B8F3G9 5.57e-105 302 74 0 188 3 efp Elongation factor P Glaesserella parasuis serovar 5 (strain SH0165)
Q7VLM1 1.16e-104 301 73 0 188 3 efp Elongation factor P Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q487P4 2.48e-103 298 72 0 186 3 efp Elongation factor P Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B7VHR3 1.98e-102 295 72 0 188 3 efp Elongation factor P Vibrio atlanticus (strain LGP32)
Q5E2B3 1.84e-101 293 72 0 188 3 efp Elongation factor P Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q0VLQ4 6.61e-98 284 68 0 188 3 efp Elongation factor P Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q1Q9C6 1.57e-95 278 67 1 189 3 efp Elongation factor P Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FR30 1.85e-95 278 67 1 189 3 efp Elongation factor P Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q609B5 8.72e-94 273 67 0 188 3 efp Elongation factor P Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q21LT5 1.08e-93 273 67 0 186 3 efp Elongation factor P Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
C5BNT8 1.7e-93 273 67 0 186 3 efp Elongation factor P Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q2SBA6 1.9e-91 268 67 1 189 3 efp Elongation factor P Hahella chejuensis (strain KCTC 2396)
A5IAG1 7.95e-91 266 64 0 188 3 efp Elongation factor P Legionella pneumophila (strain Corby)
Q5X888 7.95e-91 266 64 0 188 3 efp Elongation factor P Legionella pneumophila (strain Paris)
Q3J7W7 8.58e-91 266 61 0 188 3 efp Elongation factor P Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q5ZYS4 9.37e-91 266 64 0 188 3 efp Elongation factor P Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5WZP1 1.53e-90 265 64 0 188 3 efp Elongation factor P Legionella pneumophila (strain Lens)
Q1QUI0 3.48e-90 265 65 1 187 3 efp Elongation factor P Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1LSP7 1.18e-89 263 62 1 189 3 efp Elongation factor P Baumannia cicadellinicola subsp. Homalodisca coagulata
Q0AAU9 2.1e-89 263 64 0 188 3 efp Elongation factor P Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A5WCQ0 2.77e-89 262 63 1 189 3 efp Elongation factor P Psychrobacter sp. (strain PRwf-1)
P64045 2.72e-88 259 62 0 188 3 efp Elongation factor P Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P64044 2.72e-88 259 62 0 188 3 efp Elongation factor P Xylella fastidiosa (strain 9a5c)
B2I707 2.72e-88 259 62 0 188 3 efp Elongation factor P Xylella fastidiosa (strain M23)
B0TW77 4.82e-88 259 64 0 188 3 efp Elongation factor P Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
P57133 1.02e-87 258 60 1 189 3 efp Elongation factor P Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A0Q415 2.41e-87 257 64 0 188 3 efp Elongation factor P Francisella tularensis subsp. novicida (strain U112)
Q83AR4 4.21e-87 256 60 0 188 1 efp Elongation factor P Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAR1 4.21e-87 256 60 0 188 3 efp Elongation factor P Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KEY9 4.21e-87 256 60 0 188 3 efp Elongation factor P Coxiella burnetii (strain Dugway 5J108-111)
B6J307 4.21e-87 256 60 0 188 3 efp Elongation factor P Coxiella burnetii (strain CbuG_Q212)
B8GQC3 5.84e-87 256 66 0 187 3 efp Elongation factor P Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
B0U3W3 8.3e-87 256 62 1 188 3 efp Elongation factor P Xylella fastidiosa (strain M12)
A4J019 3.3e-86 254 64 0 188 3 efp Elongation factor P Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NI60 3.3e-86 254 64 0 188 3 efp Elongation factor P Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BNX7 3.3e-86 254 64 0 188 3 efp Elongation factor P Francisella tularensis subsp. holarctica (strain OSU18)
B2SE64 3.3e-86 254 64 0 188 3 efp Elongation factor P Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A5M4 3.3e-86 254 64 0 188 3 efp Elongation factor P Francisella tularensis subsp. holarctica (strain LVS)
A7N9M0 3.3e-86 254 64 0 188 3 efp Elongation factor P Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14JL2 3.3e-86 254 64 0 188 3 efp Elongation factor P Francisella tularensis subsp. tularensis (strain FSC 198)
B6J9B6 3.85e-86 254 60 0 188 3 efp Elongation factor P Coxiella burnetii (strain CbuK_Q154)
A1WYI1 8.95e-86 253 62 0 188 3 efp Elongation factor P Halorhodospira halophila (strain DSM 244 / SL1)
Q6FAA9 1.03e-85 253 62 1 188 3 efp Elongation factor P Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A5EX42 1.8e-85 253 64 0 188 3 efp Elongation factor P Dichelobacter nodosus (strain VCS1703A)
A3M7E3 8.08e-85 251 60 1 188 3 efp Elongation factor P Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HVL6 8.08e-85 251 60 1 188 3 efp Elongation factor P Acinetobacter baumannii (strain ACICU)
B7I499 8.08e-85 251 60 1 188 3 efp Elongation factor P Acinetobacter baumannii (strain AB0057)
B7GZ38 8.08e-85 251 60 1 188 3 efp Elongation factor P Acinetobacter baumannii (strain AB307-0294)
A6VTQ2 6.77e-84 249 60 1 187 3 efp Elongation factor P Marinomonas sp. (strain MWYL1)
O51834 2.08e-83 247 61 1 187 3 efp Elongation factor P (Fragment) Buchnera aphidicola subsp. Myzus persicae
Q8KA80 4.95e-83 246 59 1 188 3 efp Elongation factor P Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B2FMF6 1.31e-81 243 57 0 188 3 efp Elongation factor P Stenotrophomonas maltophilia (strain K279a)
A1AVI4 3.49e-80 239 58 0 186 3 efp Elongation factor P Ruthia magnifica subsp. Calyptogena magnifica
B4SQB1 1.06e-78 235 61 0 188 3 efp Elongation factor P Stenotrophomonas maltophilia (strain R551-3)
Q8P8G9 7.49e-77 231 60 0 188 3 efp Elongation factor P Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RS24 7.49e-77 231 60 0 188 3 efp Elongation factor P Xanthomonas campestris pv. campestris (strain B100)
Q4UVL7 7.49e-77 231 60 0 188 3 efp Elongation factor P Xanthomonas campestris pv. campestris (strain 8004)
Q2P2C1 2.09e-76 229 60 0 188 3 efp Elongation factor P Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BSF5 2.29e-76 229 60 0 188 3 efp Elongation factor P Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PJZ7 7.7e-76 228 59 0 188 3 efp Elongation factor P Xanthomonas axonopodis pv. citri (strain 306)
A5CXM6 3.12e-75 226 56 0 186 3 efp Elongation factor P Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q493W6 2.06e-73 222 54 0 188 3 efp Elongation factor P Blochmanniella pennsylvanica (strain BPEN)
A0L673 7.38e-69 210 50 0 184 3 efp Elongation factor P Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q8D2R7 8.02e-67 205 46 0 188 3 efp Elongation factor P Wigglesworthia glossinidia brevipalpis
Q7VQQ0 2.12e-61 191 44 0 185 3 efp Elongation factor P Blochmanniella floridana
A0RQC0 6.52e-61 190 47 0 186 3 efp Elongation factor P Campylobacter fetus subsp. fetus (strain 82-40)
Q89B31 1.39e-59 187 42 1 188 3 efp Elongation factor P Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q5HVL5 1.65e-58 184 47 0 186 3 efp Elongation factor P Campylobacter jejuni (strain RM1221)
A1VYR0 1.65e-58 184 47 0 186 3 efp Elongation factor P Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PHW3 1.65e-58 184 47 0 186 3 efp Elongation factor P Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7H4J1 1.65e-58 184 47 0 186 3 efp Elongation factor P Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FKX4 1.65e-58 184 47 0 186 3 efp Elongation factor P Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q74CC2 2.1e-58 184 45 0 185 3 efp2 Elongation factor P 2 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A5D339 3.4e-57 181 46 0 183 3 efp Elongation factor P Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B0K0T5 7.07e-57 180 44 0 183 3 efp Elongation factor P Thermoanaerobacter sp. (strain X514)
B0K9C8 7.07e-57 180 44 0 183 3 efp Elongation factor P Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B8FLV5 7.61e-57 180 44 0 184 3 efp Elongation factor P Desulfatibacillum aliphaticivorans
B9KD70 9.24e-57 180 45 0 186 3 efp Elongation factor P Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A8MFK4 1.29e-56 179 45 0 183 3 efp Elongation factor P Alkaliphilus oremlandii (strain OhILAs)
Q2RI92 1.32e-56 179 46 0 182 3 efp Elongation factor P Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q6MAZ6 1.57e-56 179 45 1 188 3 efp2 Elongation factor P 2 Protochlamydia amoebophila (strain UWE25)
O84757 1.57e-56 179 47 1 188 3 efp2 Elongation factor P 2 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q8RAE2 1.69e-56 179 43 0 183 3 efp Elongation factor P Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q821R5 2.18e-56 179 46 1 188 3 efp2 Elongation factor P 2 Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q1AW08 2.32e-56 179 44 0 183 3 efp Elongation factor P Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
B8D2E5 3.71e-56 178 46 0 183 3 efp Elongation factor P Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A4J3D4 5.93e-56 177 45 0 183 3 efp Elongation factor P Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A3DDQ3 8.05e-56 177 45 0 183 1 efp Elongation factor P Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q9PLH1 1.26e-55 177 46 1 188 3 efp2 Elongation factor P 2 Chlamydia muridarum (strain MoPn / Nigg)
Q18BA9 1.67e-55 176 43 0 183 3 efp Elongation factor P Clostridioides difficile (strain 630)
Q6APZ9 1.96e-55 176 43 0 184 3 efp Elongation factor P Desulfotalea psychrophila (strain LSv54 / DSM 12343)
O67376 2.15e-55 176 46 1 189 3 efp Elongation factor P Aquifex aeolicus (strain VF5)
A6TR25 2.53e-55 176 44 0 183 3 efp Elongation factor P Alkaliphilus metalliredigens (strain QYMF)
Q7UXN7 2.75e-55 176 45 0 187 3 efp Elongation factor P Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q9Z711 3.45e-55 176 44 1 188 3 efp2 Elongation factor P 2 Chlamydia pneumoniae
Q7M904 3.74e-55 176 42 0 185 3 efp Elongation factor P Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
C4Z8W1 6.98e-55 175 46 0 183 3 efp Elongation factor P Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q2LRN9 7.84e-55 175 42 0 185 3 efp Elongation factor P Syntrophus aciditrophicus (strain SB)
B1VDM5 1.84e-54 174 45 1 187 3 efp Elongation factor P Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
B5Y8M4 3.28e-54 173 44 0 183 3 efp Elongation factor P Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
Q3AAZ2 1.27e-53 172 45 0 183 3 efp Elongation factor P Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A8ZVH5 1.46e-53 172 44 0 185 3 efp Elongation factor P Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q17YT0 2.51e-53 171 43 0 182 3 efp Elongation factor P Helicobacter acinonychis (strain Sheeba)
Q67N94 2.9e-53 171 46 0 182 3 efp Elongation factor P Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B1I3C0 2.94e-53 171 45 0 182 3 efp Elongation factor P Desulforudis audaxviator (strain MP104C)
Q1CUY2 5.27e-53 170 43 0 182 3 efp Elongation factor P Helicobacter pylori (strain HPAG1)
B6JPS3 5.27e-53 170 43 0 182 3 efp Elongation factor P Helicobacter pylori (strain P12)
P56004 7.8e-53 170 43 0 182 3 efp Elongation factor P Helicobacter pylori (strain ATCC 700392 / 26695)
B2US06 7.8e-53 170 43 0 182 3 efp Elongation factor P Helicobacter pylori (strain Shi470)
B5Z9V0 7.8e-53 170 43 0 182 3 efp Elongation factor P Helicobacter pylori (strain G27)
B8I3C7 1.36e-52 169 44 0 181 3 efp Elongation factor P Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q9ZMQ5 2.29e-52 169 43 0 182 3 efp Elongation factor P Helicobacter pylori (strain J99 / ATCC 700824)
B2TRQ5 2.43e-52 168 42 0 183 3 efp Elongation factor P Clostridium botulinum (strain Eklund 17B / Type B)
B2V4S9 2.43e-52 168 42 0 183 3 efp Elongation factor P Clostridium botulinum (strain Alaska E43 / Type E3)
Q6MKB4 2.67e-52 168 41 0 184 3 efp Elongation factor P Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q7VJY4 2.98e-52 168 45 0 182 3 efp Elongation factor P Helicobacter hepaticus (strain ATCC 51449 / 3B1)
B2A549 4.86e-52 168 42 0 184 3 efp Elongation factor P Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q5YTL1 5.43e-52 167 43 0 182 3 efp Elongation factor P Nocardia farcinica (strain IFM 10152)
A4XJ18 8.99e-52 167 42 0 180 3 efp Elongation factor P Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B9MLY0 1.09e-51 167 43 0 180 3 efp Elongation factor P Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A0LUG7 1.68e-51 166 44 0 182 3 efp Elongation factor P Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
C0QBX7 1.94e-51 166 44 0 184 3 efp Elongation factor P Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
A0Q087 3.59e-51 166 44 0 183 3 efp Elongation factor P Clostridium novyi (strain NT)
Q2JUZ8 4.09e-51 165 42 0 182 3 efp Elongation factor P Synechococcus sp. (strain JA-3-3Ab)
B1XKV1 4.27e-51 165 46 0 182 3 efp Elongation factor P Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A5N7H7 5.14e-51 165 44 0 183 3 efp Elongation factor P Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Q5FJG2 6.27e-51 165 42 0 186 3 efp2 Elongation factor P 2 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A4X611 1.03e-50 164 46 0 182 3 efp Elongation factor P Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
B0TEH1 1.15e-50 164 42 0 182 3 efp Elongation factor P Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q4JVG5 1.22e-50 164 44 1 187 3 efp Elongation factor P Corynebacterium jeikeium (strain K411)
Q9K951 1.3e-50 164 46 0 182 3 efp Elongation factor P Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
C4XT92 1.51e-50 164 43 0 182 3 efp Elongation factor P Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
C4LIU5 1.89e-50 164 43 1 187 3 efp Elongation factor P Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
B0S053 2.01e-50 164 41 0 180 3 efp Elongation factor P Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
C5C680 2.41e-50 163 44 0 183 3 efp Elongation factor P Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q55119 2.48e-50 163 46 0 182 3 efp Elongation factor P Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q894F6 3.35e-50 163 44 0 183 3 efp Elongation factor P Clostridium tetani (strain Massachusetts / E88)
A8LY10 3.85e-50 163 45 0 182 3 efp Elongation factor P Salinispora arenicola (strain CNS-205)
A9KMD6 4.16e-50 163 43 0 183 3 efp Elongation factor P Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q0SRY9 1.04e-49 162 42 0 183 3 efp Elongation factor P Clostridium perfringens (strain SM101 / Type A)
Q8XJC5 1.04e-49 162 42 0 183 3 efp Elongation factor P Clostridium perfringens (strain 13 / Type A)
Q0TPC2 1.04e-49 162 42 0 183 3 efp Elongation factor P Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B4U7D5 1.36e-49 162 41 0 181 3 efp Elongation factor P Hydrogenobaculum sp. (strain Y04AAS1)
Q0AZH4 1.42e-49 161 43 0 183 3 efp Elongation factor P Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A4FBF7 1.96e-49 161 42 0 183 3 efp Elongation factor P Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q2JP65 2.02e-49 161 42 0 182 3 efp Elongation factor P Synechococcus sp. (strain JA-2-3B'a(2-13))
B8FQ76 2.15e-49 161 43 0 182 3 efp Elongation factor P Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B7GHE5 3.79e-49 160 44 0 182 3 efp Elongation factor P Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q741J3 5.9e-49 160 42 0 183 3 efp Elongation factor P Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QI55 5.9e-49 160 42 0 183 3 efp Elongation factor P Mycobacterium avium (strain 104)
Q24UX6 6.83e-49 159 43 0 182 3 efp Elongation factor P Desulfitobacterium hafniense (strain Y51)
Q812U1 1.01e-48 159 44 0 182 3 efp Elongation factor P Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HB68 1.01e-48 159 44 0 182 3 efp Elongation factor P Bacillus cereus (strain B4264)
B8E240 1.06e-48 159 43 0 182 3 efp Elongation factor P Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
A7GSL5 1.28e-48 159 43 0 182 3 efp Elongation factor P Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A0QWR4 1.36e-48 159 43 0 183 1 efp Elongation factor P Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
B1KT65 1.84e-48 159 43 0 183 3 efp Elongation factor P Clostridium botulinum (strain Loch Maree / Type A3)
A7GEK9 1.84e-48 159 43 0 183 3 efp Elongation factor P Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IMQ0 1.84e-48 159 43 0 183 3 efp Elongation factor P Clostridium botulinum (strain Okra / Type B1)
C1FPC4 1.84e-48 159 43 0 183 3 efp Elongation factor P Clostridium botulinum (strain Kyoto / Type A2)
A5I321 1.84e-48 159 43 0 183 3 efp Elongation factor P Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KXD8 1.84e-48 159 43 0 183 3 efp Elongation factor P Clostridium botulinum (strain 657 / Type Ba4)
A7FUV2 1.84e-48 159 43 0 183 3 efp Elongation factor P Clostridium botulinum (strain ATCC 19397 / Type A)
Q6NH07 2.02e-48 159 43 1 187 3 efp Elongation factor P Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q7UA67 2.09e-48 158 47 0 182 3 efp Elongation factor P Parasynechococcus marenigrum (strain WH8102)
Q6HDW8 2.1e-48 158 44 0 182 3 efp Elongation factor P Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q634Y7 2.1e-48 158 44 0 182 3 efp Elongation factor P Bacillus cereus (strain ZK / E33L)
B7JM48 2.1e-48 158 44 0 182 3 efp Elongation factor P Bacillus cereus (strain AH820)
Q6KMS8 2.1e-48 158 44 0 182 3 efp Elongation factor P Bacillus anthracis
A0RII7 2.1e-48 158 44 0 182 3 efp Elongation factor P Bacillus thuringiensis (strain Al Hakam)
C3LKM5 2.1e-48 158 44 0 182 3 efp Elongation factor P Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P7X5 2.1e-48 158 44 0 182 3 efp Elongation factor P Bacillus anthracis (strain A0248)
Q0IE51 2.2e-48 158 47 0 182 3 efp Elongation factor P Synechococcus sp. (strain CC9311)
B7IXI8 2.34e-48 158 43 0 182 3 efp Elongation factor P Bacillus cereus (strain G9842)
C0ZZC0 2.65e-48 158 40 0 183 3 efp Elongation factor P Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q0S0M7 2.99e-48 158 40 0 183 3 efp Elongation factor P Rhodococcus jostii (strain RHA1)
C1ERR9 3.2e-48 158 44 0 182 3 efp Elongation factor P Bacillus cereus (strain 03BB102)
B9IXJ1 3.65e-48 158 44 0 182 3 efp Elongation factor P Bacillus cereus (strain Q1)
B7HNW0 3.65e-48 158 44 0 182 3 efp Elongation factor P Bacillus cereus (strain AH187)
Q730Z6 3.65e-48 158 44 0 182 3 efp Elongation factor P Bacillus cereus (strain ATCC 10987 / NRS 248)
B5YDZ9 3.77e-48 158 42 0 182 3 efp Elongation factor P Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B1W455 3.83e-48 158 45 1 184 3 efp Elongation factor P Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B5YJ32 4.57e-48 157 38 0 184 3 efp Elongation factor P Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A2BZC9 5.09e-48 157 45 0 182 3 efp Elongation factor P Prochlorococcus marinus (strain NATL1A)
P9WNM3 5.09e-48 157 42 1 187 1 efp Elongation factor P Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNM2 5.09e-48 157 42 1 187 3 efp Elongation factor P Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U5N3 5.09e-48 157 42 1 187 3 efp Elongation factor P Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AF02 5.09e-48 157 42 1 187 3 efp Elongation factor P Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KLN1 5.09e-48 157 42 1 187 3 efp Elongation factor P Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P64035 5.09e-48 157 42 1 187 3 efp Elongation factor P Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q46I36 5.86e-48 157 45 0 182 3 efp Elongation factor P Prochlorococcus marinus (strain NATL2A)
A5GPX5 6.21e-48 157 46 0 182 3 efp Elongation factor P Synechococcus sp. (strain RCC307)
Q8FT34 6.26e-48 157 43 0 183 3 efp Elongation factor P Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A1SJD7 6.98e-48 157 44 1 188 3 efp Elongation factor P Nocardioides sp. (strain ATCC BAA-499 / JS614)
B2J711 8.53e-48 157 45 0 182 3 efp Elongation factor P Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A4IQT4 8.72e-48 157 43 0 182 3 efp Elongation factor P Geobacillus thermodenitrificans (strain NG80-2)
B2HND2 9.16e-48 157 42 0 183 3 efp Elongation factor P Mycobacterium marinum (strain ATCC BAA-535 / M)
A5GHP3 9.89e-48 157 47 0 182 3 efp Elongation factor P Synechococcus sp. (strain WH7803)
Q5KX91 9.93e-48 157 43 0 182 3 efp Elongation factor P Geobacillus kaustophilus (strain HTA426)
Q5N1T5 1.22e-47 156 45 0 182 3 efp Elongation factor P Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q54760 1.22e-47 156 45 0 182 3 efp Elongation factor P Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A0PPH6 1.33e-47 156 42 0 183 3 efp Elongation factor P Mycobacterium ulcerans (strain Agy99)
Q9CCS0 1.45e-47 156 41 1 187 3 efp Elongation factor P Mycobacterium leprae (strain TN)
B8ZUK6 1.45e-47 156 41 1 187 3 efp Elongation factor P Mycobacterium leprae (strain Br4923)
B8DJK7 1.69e-47 156 42 0 183 3 efp Elongation factor P Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q827R5 1.76e-47 156 44 1 184 3 efp Elongation factor P Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B1HS10 1.91e-47 156 43 0 182 3 efp Elongation factor P Lysinibacillus sphaericus (strain C3-41)
B7KGU8 2.2e-47 156 43 0 182 3 efp Elongation factor P Gloeothece citriformis (strain PCC 7424)
C3PGM2 2.49e-47 155 41 0 182 3 efp Elongation factor P Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
C1B4I4 2.63e-47 155 40 0 183 3 efp Elongation factor P Rhodococcus opacus (strain B4)
A2C5M7 3.7e-47 155 46 0 182 3 efp Elongation factor P Prochlorococcus marinus (strain MIT 9303)
Q9KXQ9 4.19e-47 155 44 1 184 3 efp Elongation factor P Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q7V9B9 4.21e-47 155 46 0 182 3 efp Elongation factor P Prochlorococcus marinus (strain MIT 9313)
Q74IL7 5.2e-47 155 42 0 186 3 efp2 Elongation factor P 2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q88WN1 7.44e-47 154 43 0 182 3 efp Elongation factor P Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B0JHV3 8.29e-47 154 43 0 182 3 efp Elongation factor P Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q97HB8 1.04e-46 154 41 0 184 3 efp Elongation factor P Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
C5D486 1.1e-46 154 43 0 182 3 efp Elongation factor P Geobacillus sp. (strain WCH70)
B7JVR7 1.25e-46 154 43 0 182 3 efp Elongation factor P Rippkaea orientalis (strain PCC 8801 / RF-1)
Q31DF8 1.36e-46 154 44 0 182 3 efp Elongation factor P Prochlorococcus marinus (strain MIT 9312)
A1T8F9 1.53e-46 154 41 0 183 3 efp Elongation factor P Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A1VDC3 1.98e-46 153 42 0 183 3 efp Elongation factor P Nitratidesulfovibrio vulgaris (strain DP4)
Q72BH0 1.98e-46 153 42 0 183 3 efp Elongation factor P Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q8DJD3 2.02e-46 153 42 0 182 3 efp Elongation factor P Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q1MSA2 2.18e-46 153 39 0 183 3 efp Elongation factor P Lawsonia intracellularis (strain PHE/MN1-00)
A8G213 2.95e-46 153 44 0 182 3 efp Elongation factor P Prochlorococcus marinus (strain MIT 9215)
Q8EQ28 4.28e-46 152 40 0 182 3 efp Elongation factor P Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A4TBX4 4.4e-46 152 41 0 183 3 efp Elongation factor P Mycolicibacterium gilvum (strain PYR-GCK)
B2V9Q7 4.51e-46 152 43 0 173 3 efp Elongation factor P Sulfurihydrogenibium sp. (strain YO3AOP1)
Q1B9G8 4.7e-46 152 40 0 183 3 efp Elongation factor P Mycobacterium sp. (strain MCS)
A1UFJ5 4.7e-46 152 40 0 183 3 efp Elongation factor P Mycobacterium sp. (strain KMS)
A3PZ56 4.7e-46 152 40 0 183 3 efp Elongation factor P Mycobacterium sp. (strain JLS)
Q5WF43 5.5e-46 152 43 0 182 3 efp Elongation factor P Shouchella clausii (strain KSM-K16)
Q3ANM0 5.59e-46 152 45 0 182 3 efp Elongation factor P Synechococcus sp. (strain CC9605)
C4Z157 5.87e-46 152 41 0 178 3 efp Elongation factor P Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
Q2J829 8.01e-46 152 41 1 187 3 efp Elongation factor P Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
C6BUE7 1.01e-45 152 41 0 184 3 efp Elongation factor P Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A2BNF2 1.34e-45 151 43 0 182 3 efp Elongation factor P Prochlorococcus marinus (strain AS9601)
Q3B0X4 1.37e-45 151 45 0 182 3 efp Elongation factor P Synechococcus sp. (strain CC9902)
B8DTW0 1.59e-45 151 40 0 182 3 efp Elongation factor P Bifidobacterium animalis subsp. lactis (strain AD011)
A3PA73 1.65e-45 151 43 0 182 3 efp Elongation factor P Prochlorococcus marinus (strain MIT 9301)
C0QQC2 1.72e-45 151 40 0 181 3 efp Elongation factor P Persephonella marina (strain DSM 14350 / EX-H1)
B1WNP3 1.85e-45 151 42 0 182 3 efp Elongation factor P Crocosphaera subtropica (strain ATCC 51142 / BH68)
A6Q7Q7 1.93e-45 151 41 2 189 3 efp Elongation factor P Sulfurovum sp. (strain NBC37-1)
Q116D6 2.14e-45 150 42 0 182 3 efp Elongation factor P Trichodesmium erythraeum (strain IMS101)
B0C899 2.47e-45 150 42 0 182 3 efp Elongation factor P Acaryochloris marina (strain MBIC 11017)
Q04WK0 3.28e-45 150 40 0 185 3 efp Elongation factor P Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04NC1 3.28e-45 150 40 0 185 3 efp Elongation factor P Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q8EXB9 3.43e-45 150 40 0 185 3 efp Elongation factor P Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P0C099 3.43e-45 150 40 0 185 3 efp Elongation factor P Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B1MCE5 3.47e-45 150 40 0 183 3 efp Elongation factor P Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
C0ZBY1 3.85e-45 150 43 0 182 3 efp Elongation factor P Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A0AIF6 4.11e-45 150 42 0 182 3 efp Elongation factor P Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B2GI94 4.23e-45 150 41 1 187 3 efp Elongation factor P Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Q7NL41 4.61e-45 150 43 1 183 3 efp Elongation factor P Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q7VEI7 4.67e-45 150 43 0 182 3 efp Elongation factor P Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
P64032 5.11e-45 150 42 0 182 3 efp Elongation factor P Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DFX3 5.11e-45 150 42 0 182 3 efp Elongation factor P Listeria monocytogenes serotype 4a (strain HCC23)
Q71ZW7 5.11e-45 150 42 0 182 3 efp Elongation factor P Listeria monocytogenes serotype 4b (strain F2365)
C1L2R1 5.11e-45 150 42 0 182 3 efp Elongation factor P Listeria monocytogenes serotype 4b (strain CLIP80459)
P64033 5.11e-45 150 42 0 182 3 efp Elongation factor P Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q30S45 5.29e-45 150 37 0 188 3 efp Elongation factor P Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A9B9I2 5.74e-45 150 43 0 182 3 efp Elongation factor P Prochlorococcus marinus (strain MIT 9211)
A8FF29 7.01e-45 149 41 0 182 3 efp Elongation factor P Bacillus pumilus (strain SAFR-032)
B3ES99 7.95e-45 149 45 3 191 3 efp Elongation factor P Amoebophilus asiaticus (strain 5a2)
A9VGY0 7.98e-45 149 42 0 182 3 efp Elongation factor P Bacillus mycoides (strain KBAB4)
Q65HH4 7.98e-45 149 42 0 182 3 efp Elongation factor P Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q45288 8.85e-45 149 41 1 187 1 efp Elongation factor P Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QEJ4 8.85e-45 149 41 1 187 3 efp Elongation factor P Corynebacterium glutamicum (strain R)
A7Z6L3 1.07e-44 149 41 0 182 3 efp Elongation factor P Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q4L6M9 1.09e-44 149 42 0 182 3 efp Elongation factor P Staphylococcus haemolyticus (strain JCSC1435)
B7GPV9 1.52e-44 149 39 0 182 3 efp Elongation factor P Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8G818 1.52e-44 149 39 0 182 3 efp Elongation factor P Bifidobacterium longum (strain NCC 2705)
B3DQ29 1.52e-44 149 39 0 182 3 efp Elongation factor P Bifidobacterium longum (strain DJO10A)
Q3MAQ3 2.67e-44 148 42 0 182 3 efp Elongation factor P Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q44247 3.35e-44 147 42 0 182 3 efp Elongation factor P Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A2BTX3 8.6e-44 147 42 0 182 3 efp Elongation factor P Prochlorococcus marinus (strain MIT 9515)
A1R701 9.56e-44 147 39 1 187 3 efp Elongation factor P Paenarthrobacter aurescens (strain TC1)
Q9RY32 1.95e-43 145 40 0 182 3 efp Elongation factor P Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q7V3P5 1.96e-43 145 42 0 182 3 efp Elongation factor P Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
A6LLA5 2.94e-43 145 40 0 176 3 efp Elongation factor P Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
P49778 3.14e-43 145 40 0 182 3 efp Elongation factor P Bacillus subtilis (strain 168)
B9DNQ4 6.65e-43 144 41 0 182 3 efp Elongation factor P Staphylococcus carnosus (strain TM300)
Q1J163 8e-43 144 40 0 182 3 efp Elongation factor P Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q76G20 8.94e-43 144 43 1 182 1 efp Elongation factor P Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72JL2 8.94e-43 144 43 1 182 3 efp Elongation factor P Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A8LE05 1.07e-42 144 40 0 183 3 efp Elongation factor P Parafrankia sp. (strain EAN1pec)
P64039 1.69e-42 143 40 0 182 3 efp Elongation factor P Staphylococcus aureus (strain MW2)
A8Z468 1.69e-42 143 40 0 182 3 efp Elongation factor P Staphylococcus aureus (strain USA300 / TCH1516)
Q6G937 1.69e-42 143 40 0 182 3 efp Elongation factor P Staphylococcus aureus (strain MSSA476)
Q6GGH0 1.69e-42 143 40 0 182 3 efp Elongation factor P Staphylococcus aureus (strain MRSA252)
P99066 1.69e-42 143 40 0 182 1 efp Elongation factor P Staphylococcus aureus (strain N315)
P64038 1.69e-42 143 40 0 182 3 efp Elongation factor P Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QH73 1.69e-42 143 40 0 182 3 efp Elongation factor P Staphylococcus aureus (strain Newman)
Q5HFN0 1.69e-42 143 40 0 182 3 efp Elongation factor P Staphylococcus aureus (strain COL)
Q2YT00 1.69e-42 143 40 0 182 3 efp Elongation factor P Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IT57 1.69e-42 143 40 0 182 3 efp Elongation factor P Staphylococcus aureus (strain JH9)
Q2FY41 1.69e-42 143 40 0 182 1 efp Elongation factor P Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FGJ3 1.69e-42 143 40 0 182 3 efp Elongation factor P Staphylococcus aureus (strain USA300)
A6U200 1.69e-42 143 40 0 182 3 efp Elongation factor P Staphylococcus aureus (strain JH1)
A7X2Q9 1.69e-42 143 40 0 182 3 efp Elongation factor P Staphylococcus aureus (strain Mu3 / ATCC 700698)
C0QW93 1.7e-42 143 40 0 181 3 efp Elongation factor P Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
A0JX80 2.74e-42 143 39 1 187 3 efp Elongation factor P Arthrobacter sp. (strain FB24)
Q30ZZ6 3.04e-42 142 38 0 183 3 efp Elongation factor P Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q5HP20 3.18e-42 142 41 0 182 3 efp Elongation factor P Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B8J031 3.7e-42 142 40 0 183 3 efp Elongation factor P Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B8H8V3 3.71e-42 142 39 1 187 3 efp Elongation factor P Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q8CP34 5.41e-42 142 41 0 182 3 efp Elongation factor P Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
B9E6R3 6.87e-42 142 40 0 182 3 efp Elongation factor P Macrococcus caseolyticus (strain JCSC5402)
C1A9H6 9.62e-42 141 34 0 185 3 efp Elongation factor P Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
C1F3T7 1.12e-41 141 40 0 179 3 efp Elongation factor P Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
Q6AF92 1.43e-41 141 37 0 184 3 efp Elongation factor P Leifsonia xyli subsp. xyli (strain CTCB07)
B8HV20 1.58e-41 141 40 0 182 3 efp Elongation factor P Cyanothece sp. (strain PCC 7425 / ATCC 29141)
B0REX1 1.98e-41 140 37 0 183 3 efp Elongation factor P Clavibacter sepedonicus
A5CRY6 1.98e-41 140 37 0 183 3 efp Elongation factor P Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
B0SU50 2.67e-41 140 37 0 180 3 efp Elongation factor P Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SII2 2.67e-41 140 37 0 180 3 efp Elongation factor P Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
B7IH59 5.64e-41 139 38 0 176 3 efp Elongation factor P Thermosipho africanus (strain TCF52B)
B3QW61 6.57e-41 139 38 2 189 3 efp Elongation factor P Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B1LAR0 1.01e-40 139 38 0 180 3 efp Elongation factor P Thermotoga sp. (strain RQ2)
A5ILJ5 1.01e-40 139 38 0 180 3 efp Elongation factor P Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9X284 1.27e-40 139 37 0 180 3 efp Elongation factor P Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q74FY7 1.47e-40 138 38 1 184 3 efp1 Elongation factor P 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A0M298 1.67e-40 138 40 2 187 3 efp Elongation factor P Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A8F7D2 3.77e-40 137 37 0 179 3 efp Elongation factor P Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
C1CZB4 6.55e-40 137 39 0 182 3 efp Elongation factor P Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q7MWN4 7.06e-40 137 42 3 190 3 efp1 Elongation factor P 1 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q7MV32 7.22e-40 137 41 2 186 3 efp2 Elongation factor P 2 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
A9B1H0 1.81e-39 135 38 0 183 3 efp Elongation factor P Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
B9K846 1.94e-39 135 38 0 180 3 efp Elongation factor P Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
B8IS61 2.2e-39 135 37 0 182 3 efp Elongation factor P Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
C4L3G0 2.4e-39 135 38 1 183 3 efp Elongation factor P Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A6GY96 3.31e-39 135 40 2 186 3 efp Elongation factor P Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q83MW6 3.48e-39 135 35 0 182 3 efp Elongation factor P Tropheryma whipplei (strain Twist)
Q83NK8 3.48e-39 135 35 0 182 3 efp Elongation factor P Tropheryma whipplei (strain TW08/27)
Q49XX3 5.31e-39 134 39 0 182 3 efp Elongation factor P Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
C5CI92 8.19e-39 134 37 0 179 3 efp Elongation factor P Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
B8H1A0 9.73e-39 134 36 0 184 3 efp Elongation factor P Caulobacter vibrioides (strain NA1000 / CB15N)
Q9AA85 9.73e-39 134 36 0 184 3 efp Elongation factor P Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8R5X5 1.59e-38 133 37 0 181 3 efp Elongation factor P Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B2S3B8 2.86e-38 132 37 0 177 3 efp Elongation factor P Treponema pallidum subsp. pallidum (strain SS14)
O83537 2.86e-38 132 37 0 177 3 efp Elongation factor P Treponema pallidum (strain Nichols)
Q3SS37 3.5e-38 132 37 0 182 3 efp Elongation factor P Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A7HJ78 3.54e-38 132 36 0 179 3 efp Elongation factor P Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
B8G711 4.71e-38 132 36 2 190 3 efp Elongation factor P Chloroflexus aggregans (strain MD-66 / DSM 9485)
A5UYR6 1.17e-37 131 38 2 189 3 efp Elongation factor P Roseiflexus sp. (strain RS-1)
A4SGK2 1.23e-37 131 39 1 185 3 efp Elongation factor P Chlorobium phaeovibrioides (strain DSM 265 / 1930)
P0A3B6 1.6e-37 130 35 0 188 3 efp Elongation factor P Rhizobium radiobacter
P0A3B5 1.6e-37 130 35 0 188 3 efp Elongation factor P Agrobacterium fabrum (strain C58 / ATCC 33970)
B3EER6 1.74e-37 130 37 1 185 3 efp Elongation factor P Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
B9LAT1 1.77e-37 130 35 2 190 3 efp Elongation factor P Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WFA4 1.77e-37 130 35 2 190 3 efp Elongation factor P Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A5FFT9 1.81e-37 130 40 2 186 3 efp Elongation factor P Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
B1YLP7 2.02e-37 130 36 1 183 3 efp Elongation factor P Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q73P31 4.15e-37 130 38 0 177 3 efp Elongation factor P Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q3ATP1 4.31e-37 130 38 1 179 3 efp Elongation factor P Chlorobium chlorochromatii (strain CaD3)
A9BEN2 4.56e-37 129 36 0 179 3 efp Elongation factor P Petrotoga mobilis (strain DSM 10674 / SJ95)
B4RHN9 6.94e-37 129 34 0 184 3 efp Elongation factor P Phenylobacterium zucineum (strain HLK1)
Q4FN36 7.16e-37 129 35 1 187 3 efp Elongation factor P Pelagibacter ubique (strain HTCC1062)
B1M2B1 8.53e-37 129 36 0 180 3 efp Elongation factor P Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B1GZJ0 1.12e-36 129 36 0 182 3 efp Elongation factor P Endomicrobium trichonymphae
B3QQR8 1.3e-36 128 38 1 185 3 efp Elongation factor P Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q2K302 1.31e-36 128 34 0 188 3 efp Elongation factor P Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A4YTY9 1.48e-36 128 35 0 182 3 efp Elongation factor P Bradyrhizobium sp. (strain ORS 278)
Q07MG7 1.63e-36 128 34 0 182 3 efp Elongation factor P Rhodopseudomonas palustris (strain BisA53)
B5ZU68 2.27e-36 128 34 0 188 3 efp Elongation factor P Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1QL03 2.46e-36 128 36 0 182 3 efp Elongation factor P Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q8YIW2 2.71e-36 127 39 0 180 3 efp Elongation factor P Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0REX2 2.71e-36 127 39 0 180 3 efp Elongation factor P Brucella melitensis biotype 2 (strain ATCC 23457)
P0C103 2.71e-36 127 39 0 180 3 efp Elongation factor P Brucella abortus biovar 1 (strain 9-941)
Q2YRC4 2.71e-36 127 39 0 180 3 efp Elongation factor P Brucella abortus (strain 2308)
B2S7E6 2.71e-36 127 39 0 180 3 efp Elongation factor P Brucella abortus (strain S19)
B3PRW7 3.11e-36 127 34 0 188 3 efp Elongation factor P Rhizobium etli (strain CIAT 652)
B0UJ99 3.37e-36 127 36 0 182 3 efp Elongation factor P Methylobacterium sp. (strain 4-46)
B6YQT1 3.65e-36 127 39 2 189 3 efp Elongation factor P Azobacteroides pseudotrichonymphae genomovar. CFP2
B1ZHM8 3.71e-36 127 36 0 180 3 efp Elongation factor P Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B4SG07 3.84e-36 127 37 1 185 3 efp Elongation factor P Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A9NGL1 3.89e-36 127 38 0 182 3 efp Elongation factor P Acholeplasma laidlawii (strain PG-8A)
Q8KG11 5.08e-36 127 38 1 185 3 efp Elongation factor P Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A5VS65 7.1e-36 126 38 0 180 3 efp Elongation factor P Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A7NJE1 9.46e-36 126 36 2 189 3 efp Elongation factor P Roseiflexus castenholzii (strain DSM 13941 / HLO8)
B6JHH8 9.52e-36 126 35 0 182 3 efp Elongation factor P Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q98F60 1.13e-35 126 39 0 186 3 efp1 Elongation factor P 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8FYZ5 1.14e-35 126 38 0 180 3 efp Elongation factor P Brucella suis biovar 1 (strain 1330)
A9WWI6 1.14e-35 126 38 0 180 3 efp Elongation factor P Brucella suis (strain ATCC 23445 / NCTC 10510)
A9M7K7 1.14e-35 126 38 0 180 3 efp Elongation factor P Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q92ST6 1.22e-35 126 36 0 188 3 efp Elongation factor P Rhizobium meliloti (strain 1021)
B9K2E5 1.28e-35 126 32 0 188 3 efp Elongation factor P Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B1VAJ8 1.54e-35 125 34 1 183 3 efp Elongation factor P Phytoplasma australiense
A7HUY3 1.56e-35 125 38 0 180 3 efp Elongation factor P Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q137K5 2.78e-35 125 34 0 182 3 efp Elongation factor P Rhodopseudomonas palustris (strain BisB5)
Q89M07 5.09e-35 124 35 0 182 3 efp Elongation factor P Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q11DG9 6.21e-35 124 38 0 180 3 efp Elongation factor P Chelativorans sp. (strain BNC1)
A6UF66 6.64e-35 124 35 0 188 3 efp Elongation factor P Sinorhizobium medicae (strain WSM419)
P70889 7.35e-35 124 38 2 186 3 efp Elongation factor P Bacteroides fragilis (strain YCH46)
Q5LI35 7.35e-35 124 38 2 186 3 efp Elongation factor P Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
B0SUL4 8.83e-35 124 34 0 184 3 efp Elongation factor P Caulobacter sp. (strain K31)
A5EIT5 1.58e-34 123 34 0 182 3 efp Elongation factor P Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q2IVV2 1.86e-34 123 34 0 182 3 efp Elongation factor P Rhodopseudomonas palustris (strain HaA2)
A1UR93 1.86e-34 123 38 0 181 3 efp Elongation factor P Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q1MAF5 2.56e-34 122 32 0 188 3 efp Elongation factor P Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A8H482 2.6e-34 122 35 2 185 3 efp Elongation factor P Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TUS6 2.6e-34 122 35 2 185 3 efp Elongation factor P Shewanella halifaxensis (strain HAW-EB4)
A5FZ78 3.03e-34 122 38 0 182 3 efp Elongation factor P Acidiphilium cryptum (strain JF-5)
C3MCN8 3.5e-34 122 35 0 188 3 efp Elongation factor P Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B1KEH1 4.05e-34 122 35 2 185 3 efp Elongation factor P Shewanella woodyi (strain ATCC 51908 / MS32)
Q0ALG8 4.05e-34 122 37 1 181 3 efp Elongation factor P Maricaulis maris (strain MCS10)
A3QE83 4.81e-34 122 35 2 184 3 efp Elongation factor P Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q8A1F7 4.82e-34 122 37 4 195 3 efp Elongation factor P Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B7KT38 6.04e-34 122 34 0 180 3 efp Elongation factor P Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q47EF1 6.14e-34 121 37 1 181 3 efp Elongation factor P Dechloromonas aromatica (strain RCB)
B9JDI1 7.23e-34 121 33 0 188 3 efp Elongation factor P Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A1W9U1 8.53e-34 121 38 1 181 3 efp Elongation factor P Acidovorax sp. (strain JS42)
B9MC94 8.53e-34 121 38 1 181 3 efp Elongation factor P Acidovorax ebreus (strain TPSY)
Q5FUC7 9.62e-34 121 39 0 182 3 efp Elongation factor P Gluconobacter oxydans (strain 621H)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_03760
Feature type CDS
Gene efp
Product elongation factor P
Location 156343 - 156909 (strand: -1)
Length 567 (nucleotides) / 188 (amino acids)

Contig

Accession contig_3
Length 210665 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_800
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01132 Elongation factor P (EF-P) OB domain
PF08207 Elongation factor P (EF-P) KOW-like domain
PF09285 Elongation factor P, C-terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0231 Translation, ribosomal structure and biogenesis (J) J Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02356 elongation factor P - -

Protein Sequence

MATYSTNEFRQGLKIMLDGEPCVVVESEFVKPGKGQAFARVRLRKLISNKLLEKTFKSTDSAEGADVMDLNLTYLYNDGEFWHFMNNETFEQLAADEKAIGDNAKWLIDQAECIVTLWDGRPIAVTPPNFVELEITETDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

Flanking regions ( +/- flanking 50bp)

TATCGACCATTTTTTTGGCTATGCCATTTATTTAAAATTAGAGGATTTCCATGGCTACTTATAGTACCAACGAATTTCGCCAAGGTCTTAAAATTATGTTAGACGGCGAACCTTGCGTGGTTGTTGAAAGTGAGTTTGTTAAACCGGGTAAAGGTCAGGCATTCGCCCGTGTGCGTCTGCGTAAACTGATCTCCAACAAACTGCTGGAGAAAACCTTCAAATCAACAGACTCTGCGGAAGGCGCTGATGTCATGGATCTGAACCTGACTTACCTGTACAACGACGGTGAGTTCTGGCACTTCATGAACAACGAAACTTTCGAGCAGCTGGCTGCGGATGAGAAAGCTATCGGTGATAACGCCAAATGGCTGATCGACCAGGCTGAATGTATCGTTACCCTGTGGGACGGCCGTCCTATCGCGGTTACCCCGCCAAACTTTGTTGAGCTGGAAATCACGGAAACCGATCCGGGCCTGAAAGGTGATACTGCCGGTACCGGCGGTAAACCAGCGACCCTGAGCACTGGTGCAGTGGTTAAAGTACCTCTGTTCGTGCAGATTGGTGAAGTGATCAAAGTTGACACCCGTTCAGGTGAATACGTTTCCCGCGTGAAATAAGATTACGTGATGAATTACAAAACCGCCGCTGAATCAGCGGCGGTTTTTTT