Homologs in group_722

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_07355 EHELCC_07355 100.0 Morganella morganii S2 degS outer membrane-stress sensor serine endopeptidase DegS
NLDBIP_07680 NLDBIP_07680 100.0 Morganella morganii S4 degS outer membrane-stress sensor serine endopeptidase DegS
LHKJJB_07215 LHKJJB_07215 100.0 Morganella morganii S3 degS outer membrane-stress sensor serine endopeptidase DegS
HKOGLL_03715 HKOGLL_03715 100.0 Morganella morganii S5 degS outer membrane-stress sensor serine endopeptidase DegS
F4V73_RS11740 F4V73_RS11740 94.3 Morganella psychrotolerans degS outer membrane-stress sensor serine endopeptidase DegS
PMI_RS18235 PMI_RS18235 70.1 Proteus mirabilis HI4320 degS outer membrane-stress sensor serine endopeptidase DegS

Distribution of the homologs in the orthogroup group_722

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_722

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEE3 6.24e-133 386 56 3 351 1 degS Serine endoprotease DegS Escherichia coli (strain K12)
P0AEE4 6.24e-133 386 56 3 351 3 degS Serine endoprotease DegS Escherichia coli O157:H7
D0ZY51 6.32e-132 384 56 4 351 3 degS Serine endoprotease DegS Salmonella typhimurium (strain 14028s / SGSC 2262)
P44947 2.92e-96 292 48 8 347 3 degS Serine endoprotease DegS Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P39099 7.64e-61 204 40 4 320 1 degQ Periplasmic pH-dependent serine endoprotease DegQ Escherichia coli (strain K12)
P0C0V0 1.04e-54 189 36 4 320 1 degP Periplasmic serine endoprotease DegP Escherichia coli (strain K12)
P0C0V1 1.04e-54 189 36 4 320 3 degP Periplasmic serine endoprotease DegP Escherichia coli O157:H7
O85291 1.35e-53 186 38 6 326 3 htrA Probable periplasmic serine endoprotease DegP-like Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57322 2.86e-53 185 35 7 335 3 degP Probable serine protease do-like Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A4XSC0 1.31e-52 183 39 5 279 3 Pmen_1471 Probable periplasmic serine endoprotease DegP-like Pseudomonas mendocina (strain ymp)
P26982 1.55e-52 183 36 4 318 3 degP Periplasmic serine endoprotease DegP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45129 1.78e-51 180 36 4 293 3 HI_1259 Probable periplasmic serine protease do/HhoA-like Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B0KV30 1.9e-51 181 37 5 279 3 PputGB1_4377 Probable periplasmic serine endoprotease DegP-like Pseudomonas putida (strain GB-1)
A5W8F5 3.48e-51 180 37 5 279 3 Pput_4291 Probable periplasmic serine endoprotease DegP-like Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B1J4D7 9.9e-51 179 38 5 279 3 PputW619_1070 Probable periplasmic serine endoprotease DegP-like Pseudomonas putida (strain W619)
Q52894 1.56e-50 179 37 4 273 3 degP1 Probable periplasmic serine endoprotease DegP-like Rhizobium meliloti (strain 1021)
Q4KGQ4 6.24e-49 174 38 5 279 3 mucD Probable periplasmic serine endoprotease DegP-like Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48EU9 1.36e-48 173 39 5 279 3 mucD Probable periplasmic serine endoprotease DegP-like Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q2SL36 3.72e-48 171 40 6 284 3 mucD Probable periplasmic serine endoprotease DegP-like Hahella chejuensis (strain KCTC 2396)
E1V4H2 3.8e-48 172 36 5 288 3 mucD Probable periplasmic serine endoprotease DegP-like Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)
E1V4H2 0.000402 45 34 0 73 3 mucD Probable periplasmic serine endoprotease DegP-like Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)
F6AA62 4.64e-48 171 37 5 279 3 Psefu_3239 Probable periplasmic serine endoprotease DegP-like Pseudomonas fulva (strain 12-X)
P0A3Z5 5.64e-48 172 37 5 274 3 htrA Probable periplasmic serine endoprotease DegP-like Brucella suis biovar 1 (strain 1330)
P0C114 5.64e-48 172 37 5 274 3 htrA Probable periplasmic serine endoprotease DegP-like Brucella abortus biovar 1 (strain 9-941)
Q2YMX6 5.64e-48 172 37 5 274 3 htrA Probable periplasmic serine endoprotease DegP-like Brucella abortus (strain 2308)
Q8YG32 6.13e-48 172 37 5 274 3 htrA Probable periplasmic serine endoprotease DegP-like Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q89AP5 5.13e-47 168 36 4 287 3 htrA Probable periplasmic serine endoprotease DegP-like Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P18584 1.38e-46 168 34 4 292 3 htrA Probable periplasmic serine endoprotease DegP-like Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
P05676 1.82e-46 166 36 7 288 3 syc0938_d Uncharacterized serine protease syc0938_d Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q9PL97 1.25e-45 165 34 3 280 3 htrA Probable periplasmic serine endoprotease DegP-like Chlamydia muridarum (strain MoPn / Nigg)
Q9Z6T0 1.83e-43 159 35 3 274 3 htrA Probable periplasmic serine endoprotease DegP-like Chlamydia pneumoniae
P73354 2.58e-43 158 35 7 291 1 htrA Putative serine protease HtrA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q92JA1 3.8e-43 159 37 4 283 3 htrA Probable periplasmic serine endoprotease DegP-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A6VUA4 4.38e-43 158 36 5 278 3 Mmwyl1_1102 Probable periplasmic serine endoprotease DegP-like Marinomonas sp. (strain MWYL1)
P54925 1.18e-42 157 32 8 327 3 htrA Probable periplasmic serine endoprotease DegP-like Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
O05942 1.36e-40 152 37 6 281 3 htrA Probable periplasmic serine endoprotease DegP-like Rickettsia prowazekii (strain Madrid E)
P72780 1.61e-39 147 35 7 288 1 hhoA Putative serine protease HhoA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P83110 2.62e-38 145 34 9 299 1 HTRA3 Serine protease HTRA3 Homo sapiens
P73940 3.6e-37 141 34 10 295 1 hhoB Putative serine protease HhoB Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9Z4H7 5.96e-37 140 34 6 289 3 htrA Serine protease Do-like HtrA Lactobacillus helveticus
O06291 6.63e-37 142 36 8 284 1 htrA1 Probable serine protease HtrA1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
O22609 9.47e-36 137 34 9 290 1 DEGP1 Protease Do-like 1, chloroplastic Arabidopsis thaliana
D3ZA76 1.49e-35 137 34 9 294 2 Htra3 Serine protease HTRA3 Rattus norvegicus
Q9D236 2.04e-35 137 34 9 294 1 Htra3 Serine protease HTRA3 Mus musculus
Q3E6S8 2.96e-35 136 32 13 334 3 DEGP14 Putative protease Do-like 14 Arabidopsis thaliana
P39668 3.87e-35 135 33 9 329 3 yyxA Uncharacterized serine protease YyxA Bacillus subtilis (strain 168)
Q9LA06 6.68e-35 135 33 8 300 1 htrA Serine protease Do-like HtrA Lactococcus lactis subsp. lactis (strain IL1403)
Q9LU10 8.23e-35 135 35 8 298 1 DEGP8 Protease Do-like 8, chloroplastic Arabidopsis thaliana
A2RNT9 8.67e-35 134 32 9 314 3 htrA Serine protease Do-like HtrA Lactococcus lactis subsp. cremoris (strain MG1363)
O34358 2.24e-34 134 33 9 293 2 htrA Serine protease Do-like HtrA Bacillus subtilis (strain 168)
B4G316 5.02e-33 130 32 8 300 3 HtrA2 Serine protease HTRA2, mitochondrial Drosophila persimilis
Q9R9I1 5.32e-33 130 33 10 288 2 htrB Serine protease Do-like HtrB Bacillus subtilis (strain 168)
Q297U2 7.68e-33 129 32 8 300 3 HtrA2 Serine protease HTRA2, mitochondrial Drosophila pseudoobscura pseudoobscura
Q92743 4.51e-32 128 31 8 293 1 HTRA1 Serine protease HTRA1 Homo sapiens
Q9QZK5 5.35e-32 128 32 8 277 2 Htra1 Serine protease HTRA1 Rattus norvegicus
A6YFB5 7.15e-32 127 31 7 291 1 htra1 Serine protease HTRA1 Xenopus laevis
F1N152 1.25e-31 127 31 8 293 2 HTRA1 Serine protease HTRA1 Bos taurus
B3LVG7 1.34e-31 126 31 8 300 3 HtrA2 Serine protease HTRA2, mitochondrial Drosophila ananassae
Q9R118 1.48e-31 127 31 8 277 1 Htra1 Serine protease HTRA1 Mus musculus
Q9VFJ3 1.94e-31 125 31 8 300 1 HtrA2 Serine protease HTRA2, mitochondrial Drosophila melanogaster
B4HEM8 2.02e-31 125 31 8 300 3 HtrA2 Serine protease HTRA2, mitochondrial Drosophila sechellia
B3P3J9 2.24e-31 125 31 8 300 3 HtrA2 Serine protease HTRA2, mitochondrial Drosophila erecta
B4QZU6 2.88e-31 125 31 8 300 3 HtrA2 Serine protease HTRA2, mitochondrial Drosophila simulans
B4JTT7 4.25e-31 125 33 7 274 3 HtrA2 Serine protease HTRA2, mitochondrial Drosophila grimshawi
B4N937 6.67e-31 124 32 7 272 3 HtrA2 Serine protease HTRA2, mitochondrial Drosophila willistoni
B4PST0 1.05e-30 124 31 8 300 3 HtrA2 Serine protease HTRA2, mitochondrial Drosophila yakuba
Q6GMI0 1.82e-30 124 31 9 297 2 htra1a Serine protease HTRA1A Danio rerio
B4K835 2.43e-30 123 31 8 300 3 HtrA2 Serine protease HTRA2, mitochondrial Drosophila mojavensis
B4LY58 3.43e-30 122 31 8 300 3 HtrA2 Serine protease HTRA2, mitochondrial Drosophila virilis
A4IHA1 5.45e-30 122 31 7 277 2 htra1 Serine protease HTRA1 Xenopus tropicalis
D3ZKF5 1.29e-29 121 30 9 317 3 Htra4 Serine protease HTR4 Rattus norvegicus
A2RT60 3.36e-29 120 29 9 317 2 Htra4 Serine protease HTRA4 Mus musculus
A9JRB3 8.95e-29 119 31 7 281 2 htra1b Serine protease HTRA1B Danio rerio
O53896 1.95e-28 118 31 10 330 1 pepD Serine protease PepD Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P83105 4.91e-27 114 29 9 285 1 HTRA4 Serine protease HTRA4 Homo sapiens
Q9JIY5 5.07e-27 114 31 10 282 1 Htra2 Serine protease HTRA2, mitochondrial Mus musculus
E1BJW1 8.24e-27 114 28 11 309 3 HTRA4 Serine protease HTR4 Bos taurus
A0JNK3 1.24e-26 113 30 8 280 2 HTRA2 Serine protease HTRA2, mitochondrial Bos taurus
O43464 2.5e-24 106 30 8 280 1 HTRA2 Serine protease HTRA2, mitochondrial Homo sapiens
V6F2B6 6.6e-22 100 37 2 167 1 mamE Magnetosome formation protease MamE Magnetospirillum gryphiswaldense (strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1)
Q2W8Q8 6.76e-22 100 37 3 175 1 mamE Magnetosome formation protease MamE Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q9SEL7 6.27e-20 92 30 5 226 1 DEGP5 Protease Do-like 5, chloroplastic Arabidopsis thaliana
Q6GI62 7.6e-20 94 27 13 339 3 SAR0992 Serine protease HtrA-like Staphylococcus aureus (strain MRSA252)
Q8NXB8 6.92e-19 91 27 11 310 3 MW0903 Serine protease HtrA-like Staphylococcus aureus (strain MW2)
Q6GAJ1 6.92e-19 91 27 11 310 3 SAS0955 Serine protease HtrA-like Staphylococcus aureus (strain MSSA476)
Q7A6C9 8.25e-19 91 27 11 310 1 SA0879 Serine protease HtrA-like Staphylococcus aureus (strain N315)
Q99V70 8.25e-19 91 27 11 310 3 SAV1023 Serine protease HtrA-like Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2FI55 8.33e-19 91 30 9 269 3 SAUSA300_0923 Serine protease HtrA-like Staphylococcus aureus (strain USA300)
Q5HH63 9.13e-19 91 30 9 269 3 SACOL1028 Serine protease HtrA-like Staphylococcus aureus (strain COL)
Q8CT52 1.21e-18 90 27 11 296 3 SE_0722/SE_0723 Serine protease HtrA-like Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQE2 1.21e-18 90 27 11 296 3 SERP0611 Serine protease HtrA-like Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q2FZP2 1.62e-18 90 29 11 298 3 SAOUHSC_00958 Serine protease HtrA-like Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2YX06 3.88e-18 89 27 11 310 3 SAB0888 Serine protease HtrA-like Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q4L530 7.19e-18 88 29 12 291 3 SH1936 Serine protease HtrA-like Staphylococcus haemolyticus (strain JCSC1435)
Q49WF1 4.66e-14 76 25 12 312 3 SSP1763 Serine protease HtrA-like Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
O82261 6.65e-11 67 24 16 318 1 DEGP2 Protease Do-like 2, chloroplastic Arabidopsis thaliana
Q2W8Q2 2.24e-07 56 25 3 174 1 mamO Probable membrane transporter protein MamO Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P55377 3.89e-07 55 27 7 155 3 NGR_a00200 Uncharacterized protein y4bJ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q93DZ1 1.87e-06 53 25 3 174 1 mamO Probable membrane transporter protein MamO Magnetospirillum gryphiswaldense (strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1)
Q9FL12 2.25e-06 53 25 13 268 1 DEGP9 Protease Do-like 9 Arabidopsis thaliana
A5DAL3 0.000191 47 23 12 342 3 NMA111 Pro-apoptotic serine protease NMA111 Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324)
A3DC20 0.000362 46 26 6 162 1 rsgI9 Anti-sigma-I factor RsgI9 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q2T9J0 0.000825 45 26 7 172 1 TYSND1 Peroxisomal leader peptide-processing protease Homo sapiens

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_03180
Feature type CDS
Gene degS
Product outer membrane-stress sensor serine endopeptidase DegS
Location 39871 - 40929 (strand: 1)
Length 1059 (nucleotides) / 352 (amino acids)

Contig

Accession contig_3
Length 210665 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_722
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13180 PDZ domain
PF13365 Trypsin-like peptidase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0265 Posttranslational modification, protein turnover, chaperones (O) O Periplasmic serine protease, S1-C subfamily, contain C-terminal PDZ domain

Protein Sequence

MGLLVAALLLVSVPSIRPQFVTQWFTHLFNNDEPVSYNKAVRRAAPAVVNVYSSNMGSLSQQGPEMTSLGSGVIMNDQGYILTNQHVIKNADQILIALQYGNYGRLYEGMLIGADDLTDLAVLKINTTDKLPVIPINPKRQSHVGDVVLAIGNPFNVGQTVNQGIISAMGRVGLSPTRRQNFLQTDASIMAGNSGGALVNTEGELVGINTMSYDSNDPSRMSDSIGLAIPAELALRIMNKLIKDGRVIRGYIGITSKELPPIRTNNSDINQITGLRVFQVARNGPADKGGIQVGDIITSVNNKPSTSPLEMMDQVAELSPGSVVPVTLLRNGQMRSVDVTIEEFTPSPGGQE

Flanking regions ( +/- flanking 50bp)

CACAACACCGGTTAAGGACTATGTGGTTTAAATTATTGCGCTCCGTTTTTATGGGACTTCTCGTGGCTGCCCTGCTTCTGGTCAGCGTCCCGTCTATTCGTCCGCAATTTGTGACCCAGTGGTTTACCCATCTGTTTAATAATGACGAACCGGTCAGCTACAACAAAGCGGTACGCCGCGCCGCGCCTGCTGTGGTCAACGTTTACAGCAGTAATATGGGCAGTCTCTCCCAGCAGGGTCCCGAAATGACCTCCCTCGGTTCCGGTGTGATCATGAATGATCAGGGTTATATCCTGACTAACCAGCACGTCATTAAAAATGCCGATCAGATCCTGATCGCCCTGCAATACGGTAATTACGGCCGCCTGTATGAAGGTATGCTGATTGGCGCGGATGATCTGACCGACCTCGCGGTGCTGAAAATCAATACCACCGATAAACTGCCGGTGATCCCGATCAACCCTAAGCGTCAGTCTCATGTGGGTGATGTGGTACTGGCGATCGGTAACCCGTTTAATGTCGGGCAGACAGTCAACCAGGGCATTATCAGTGCAATGGGCCGTGTCGGGCTGAGTCCGACTCGCCGCCAGAATTTTCTCCAGACTGATGCCTCGATTATGGCCGGTAACTCCGGCGGCGCACTCGTCAATACCGAAGGCGAGTTAGTCGGCATCAATACCATGTCTTACGACAGCAATGATCCGTCACGGATGAGTGACAGCATCGGGCTGGCGATCCCCGCAGAGCTTGCCCTGCGCATTATGAATAAGCTGATAAAAGACGGCCGTGTGATCCGGGGCTATATCGGCATCACCTCCAAAGAGCTGCCGCCGATCCGGACTAACAACAGTGATATCAATCAGATAACCGGTCTGCGGGTCTTTCAGGTTGCCCGTAACGGCCCGGCGGATAAAGGCGGGATTCAGGTCGGGGATATCATCACCAGCGTCAATAACAAACCGAGCACCTCACCACTCGAAATGATGGATCAGGTGGCGGAACTGAGCCCGGGCAGTGTTGTGCCGGTCACCCTGTTACGCAATGGTCAGATGCGGTCTGTCGATGTGACCATCGAGGAGTTCACTCCCTCCCCCGGCGGACAGGAATAAGACACAAAAAAAGAGCGGATATCCGCTCTTTTCTGTTTATGGCTTACATC